Citrus Sinensis ID: 030323

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MGLHGQLIDLSSDSLPLLIVALIANCFGNLRSLLFSLLHSVGMTRVDPVQNNPAGPHVGSGLASLIVLAEQLNKNRAFSYKYNNNNNINKINDNCCCGQGVASSAAGSDCMVCLCTLRDGELVRKLDCRHVFHKDCLDGWLHHLNFNCPLCRSPVVSEERVWNTRRRVGGDLIQWFSLR
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHccccccccccccccccccccHHHHccccccccEEEEcc
*G*******LSSDSLPLLIVALIANCFGNLRSLLFSLLHSVGMTRVDPVQ*****PHVGSGLASLIVLAEQL**********************************GSDCMVCLCTLRDGELVRKLDCRHVFHKDCLDGWLHHLNFNCPLCRSPVVSEERVWNTRRRVGGDLIQWFSLR
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLHGQLIDLSSDSLPLLIVALIANCFGNLRSLLFSLLHSVGMTRVDPVQNNPAGPHVGSGLASLIVLAEQLNKNRAFSYKYNNNNNINKINDNCCCGQGVASSAAGSDCMVCLCTLRDGELVRKLDCRHVFHKDCLDGWLHHLNFNCPLCRSPVVSEERVWNTRRRVGGDLIQWFSLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase RHA2A E3 ubiquitin-protein ligase involved in the positive regulation of abscisic acid (ABA) signaling and responses to salt and osmotic stresses during seed germination and early seedling development. Possesses E3 ubiquitin ligase activity in vitro.probableQ9ZT50

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ECT, chain A
Confidence level:very confident
Coverage over the Query: 105-163
View the alignment between query and template
View the model in PyMOL