Query         030333
Match_columns 179
No_of_seqs    134 out of 148
Neff          4.1 
Searched_HMMs 46136
Date          Fri Mar 29 12:08:21 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030333.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030333hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2612 Predicted integral mem 100.0 9.9E-30 2.2E-34  191.7   4.4   99    9-122     5-103 (103)
  2 PF08209 Sgf11:  Sgf11 (transcr  99.8 1.2E-20 2.5E-25  118.6   1.4   32   91-122     2-33  (33)
  3 PF13913 zf-C2HC_2:  zinc-finge  96.4 0.00093   2E-08   39.2   0.2   23   93-115     2-24  (25)
  4 smart00734 ZnF_Rad18 Rad18-lik  95.5  0.0049 1.1E-07   36.6   0.6   25   93-117     1-25  (26)
  5 KOG3623 Homeobox transcription  86.1    0.38 8.3E-06   48.5   1.6   66   91-156   307-376 (1007)
  6 PF12230 PRP21_like_P:  Pre-mRN  77.6    0.73 1.6E-05   38.8   0.0   26   91-116   166-191 (229)
  7 TIGR00599 rad18 DNA repair pro  73.7     1.2 2.6E-05   41.5   0.4   30   91-120   179-209 (397)
  8 PF07754 DUF1610:  Domain of un  71.9     2.5 5.5E-05   25.0   1.3   11   90-100    13-23  (24)
  9 PF05605 zf-Di19:  Drought indu  71.5     1.6 3.5E-05   29.0   0.5   23   93-115     2-24  (54)
 10 COG5432 RAD18 RING-finger-cont  68.4     3.1 6.8E-05   38.3   1.8   29   90-118   157-185 (391)
 11 PF12647 RNHCP:  RNHCP domain;   61.9     3.1 6.8E-05   31.8   0.5   27   91-117     2-32  (92)
 12 PLN03086 PRLI-interacting fact  58.0       5 0.00011   39.2   1.2   27   91-117   405-431 (567)
 13 PF12269 zf-CpG_bind_C:  CpG bi  53.5      55  0.0012   28.9   6.8   29   90-118    81-109 (236)
 14 COG4481 Uncharacterized protei  52.9     6.2 0.00013   28.0   0.7   18   91-108    32-49  (60)
 15 PF12209 SAC3:  Leucine permeas  52.5      26 0.00056   25.7   3.9   27   12-38     39-65  (79)
 16 COG1110 Reverse gyrase [DNA re  51.9     5.1 0.00011   42.0   0.2   28   94-121     9-38  (1187)
 17 PRK14701 reverse gyrase; Provi  51.4     5.6 0.00012   43.2   0.4   25   93-117     6-32  (1638)
 18 PF02591 DUF164:  Putative zinc  51.1     9.3  0.0002   25.6   1.3   12   91-102    44-55  (56)
 19 PF02892 zf-BED:  BED zinc fing  48.9     7.3 0.00016   24.4   0.5   24   90-113    13-41  (45)
 20 PF13248 zf-ribbon_3:  zinc-rib  47.4     9.5 0.00021   22.1   0.8   17   94-110     3-20  (26)
 21 PF03884 DUF329:  Domain of unk  46.9     9.6 0.00021   26.7   0.9   23   93-115     2-28  (57)
 22 PF13240 zinc_ribbon_2:  zinc-r  46.5     9.7 0.00021   21.8   0.7   11   95-105     1-11  (23)
 23 PF11023 DUF2614:  Protein of u  45.0      11 0.00024   29.9   1.1   24   91-118    67-91  (114)
 24 COG2888 Predicted Zn-ribbon RN  44.8      14 0.00031   26.4   1.5   17   87-103    21-37  (61)
 25 PF00096 zf-C2H2:  Zinc finger,  43.2      12 0.00025   20.2   0.7   11   94-104     1-11  (23)
 26 PF02176 zf-TRAF:  TRAF-type zi  41.9      12 0.00026   24.5   0.7   26   92-117     8-36  (60)
 27 PF10571 UPF0547:  Uncharacteri  41.1      12 0.00026   22.2   0.5   17   95-111     2-19  (26)
 28 PF05253 zf-U11-48K:  U11-48K-l  39.9      22 0.00047   20.9   1.6   24   93-116     2-26  (27)
 29 PRK00398 rpoP DNA-directed RNA  38.8      12 0.00026   24.1   0.3   12   93-104    21-32  (46)
 30 PF06107 DUF951:  Bacterial pro  38.3      16 0.00035   25.7   0.9   16   93-108    31-46  (57)
 31 PRK14890 putative Zn-ribbon RN  37.4      22 0.00048   25.2   1.5   13   90-102    22-34  (59)
 32 PF07295 DUF1451:  Protein of u  37.4      12 0.00027   30.3   0.3   29   93-122   112-140 (146)
 33 TIGR01054 rgy reverse gyrase.   36.1      12 0.00025   39.3  -0.0   25   93-117     7-33  (1171)
 34 PRK09401 reverse gyrase; Revie  35.7      13 0.00028   39.1   0.2   25   93-117     7-33  (1176)
 35 PF04423 Rad50_zn_hook:  Rad50   35.2      15 0.00033   24.3   0.4   14   95-108    22-35  (54)
 36 PRK06266 transcription initiat  33.9      22 0.00048   29.4   1.2   17   89-105   113-129 (178)
 37 PF14353 CpXC:  CpXC protein     32.7      23 0.00051   26.9   1.1   13   93-105    38-50  (128)
 38 smart00531 TFIIE Transcription  32.3      25 0.00055   27.8   1.3   17   90-106    96-112 (147)
 39 PF10601 zf-LITAF-like:  LITAF-  31.3      29 0.00063   24.2   1.3   17   91-107    56-72  (73)
 40 PF12677 DUF3797:  Domain of un  30.7      20 0.00042   24.7   0.3   16   90-105    10-25  (49)
 41 TIGR00373 conserved hypothetic  30.5      28  0.0006   28.2   1.2   16   89-104   105-120 (158)
 42 KOG2186 Cell growth-regulating  30.4      22 0.00048   32.0   0.7   27   90-117    26-52  (276)
 43 TIGR02098 MJ0042_CXXC MJ0042 f  30.0      36 0.00078   20.7   1.5   14   92-105    24-37  (38)
 44 KOG3940 Uncharacterized conser  29.6      25 0.00053   32.6   0.9   33   87-119   316-348 (351)
 45 PRK02935 hypothetical protein;  28.7      30 0.00066   27.3   1.1   13   91-103    68-80  (110)
 46 PF09889 DUF2116:  Uncharacteri  28.1      26 0.00057   24.6   0.7   13   94-106     4-16  (59)
 47 PRK00418 DNA gyrase inhibitor;  28.1      30 0.00066   24.7   1.0   25   92-116     5-33  (62)
 48 TIGR01206 lysW lysine biosynth  26.9      26 0.00057   24.1   0.5   14   93-106     2-15  (54)
 49 PF12773 DZR:  Double zinc ribb  26.6      35 0.00077   21.8   1.0   12   93-104    12-23  (50)
 50 PF11113 Phage_head_chap:  Head  26.5      27 0.00059   24.6   0.5   12  107-118    43-54  (56)
 51 PF14577 SEO_C:  Sieve element   26.3      33 0.00072   30.2   1.1   13   92-104   213-225 (235)
 52 PRK01343 zinc-binding protein;  25.9      49  0.0011   23.3   1.7   19   91-110     7-25  (57)
 53 TIGR03826 YvyF flagellar opero  25.8      34 0.00075   27.6   1.0   26   90-118    78-103 (137)
 54 PF13465 zf-H2C2_2:  Zinc-finge  25.7      32 0.00069   19.7   0.6   11   93-103    14-24  (26)
 55 PF10609 ParA:  ParA/MinD ATPas  24.6      34 0.00073   25.4   0.7   24   78-104    53-76  (81)
 56 PRK14892 putative transcriptio  24.5      37 0.00081   26.0   1.0   11   91-101    19-29  (99)
 57 cd02341 ZZ_ZZZ3 Zinc finger, Z  23.9      33 0.00072   22.9   0.5   15   94-108     1-16  (48)
 58 KOG2593 Transcription initiati  23.0      65  0.0014   30.9   2.4   13   92-104   152-164 (436)
 59 PF05304 DUF728:  Protein of un  22.7      46   0.001   25.9   1.2   26   93-118    39-75  (103)
 60 PF13894 zf-C2H2_4:  C2H2-type   22.7      44 0.00096   17.2   0.8   20   94-113     1-21  (24)
 61 cd02340 ZZ_NBR1_like Zinc fing  22.1      40 0.00086   21.8   0.6   14   95-108     2-15  (43)
 62 COG1579 Zn-ribbon protein, pos  22.0      36 0.00077   29.9   0.5   14   90-103   218-231 (239)
 63 PF08790 zf-LYAR:  LYAR-type C2  21.9      53  0.0012   20.1   1.1   23   94-117     1-23  (28)
 64 PF10013 DUF2256:  Uncharacteri  21.8      41 0.00089   22.4   0.6   12   93-104     8-19  (42)
 65 COG2051 RPS27A Ribosomal prote  21.6      57  0.0012   23.7   1.4   14   91-104    36-49  (67)
 66 PF08271 TF_Zn_Ribbon:  TFIIB z  21.6      45 0.00098   21.1   0.8   10   94-103     1-10  (43)
 67 PF03847 TFIID_20kDa:  Transcri  21.4 2.1E+02  0.0045   20.3   4.2   34    7-40     13-46  (68)
 68 PF11687 DUF3284:  Domain of un  20.9      96  0.0021   23.8   2.6   23   16-38     11-33  (120)
 69 smart00714 LITAF Possible memb  20.4      58  0.0012   22.3   1.2   16   91-106    50-65  (67)
 70 COG5248 TAF19 Transcription in  20.0 1.8E+02   0.004   23.3   4.0   33    7-40     24-56  (126)

No 1  
>KOG2612 consensus Predicted integral membrane protein [Function unknown]
Probab=99.96  E-value=9.9e-30  Score=191.69  Aligned_cols=99  Identities=31%  Similarity=0.494  Sum_probs=85.1

Q ss_pred             cchHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhccCccchhhHHHHHHHHHhhhhhcCCCCCCCCCCCcccceeCccCCC
Q 030333            9 MSAHSQLSSHFFEDLLDSIIVDVASECHRVARLGLDRNFEEEEEELRLSAQARARVADSSNNGETNSKYVVDIFGQTHPA   88 (179)
Q Consensus         9 ~s~l~~LA~~Iy~dLLddiIlDIv~EvHR~~KlGl~~~l~~~~~el~~~~~a~~~~~Dps~~~~~~~~~~~DIfG~~~~~   88 (179)
                      ...++++++.||++|||+.|+||+.|.|+.+|+|-...++...|.      ..+++ +|.        +.+||||..+++
T Consensus         5 ~iniDe~aNgilnnLL~~~iqdI~a~e~~~qkl~k~~~~D~rped------ssY~f-~~~--------gnLDI~Giqkqa   69 (103)
T KOG2612|consen    5 PINIDEAANGILNNLLDDAIQDIFAEEHHLQKLGKLAALDGRPED------SSYRF-CEM--------GNLDIFGIQKQA   69 (103)
T ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccCCCCccc------cceee-cCC--------CCcchhhhhhhc
Confidence            456899999999999999999999999999999988887754332      22333 333        579999999999


Q ss_pred             CCCceeeeCCCCCcccccccchhHHHhhcCCccc
Q 030333           89 VANEIFECMNCGRSIVAGRFAPHLEKCMGKGRKA  122 (179)
Q Consensus        89 ~~~~~~~C~nC~R~v~a~RfA~HLekCmg~gr~s  122 (179)
                      +...+++|+||+|.|+|+|||||||||||||++|
T Consensus        70 ek~~~~hCeNC~RdVaAaR~AaHLekCl~~Ga~r  103 (103)
T KOG2612|consen   70 EKPMDCHCENCDRDVAAARFAAHLEKCLGMGAIR  103 (103)
T ss_pred             cCCccccCCCCccHHHHHHHHHHHHHHHhccccC
Confidence            9999999999999999999999999999999864


No 2  
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=99.80  E-value=1.2e-20  Score=118.59  Aligned_cols=32  Identities=63%  Similarity=1.274  Sum_probs=25.5

Q ss_pred             CceeeeCCCCCcccccccchhHHHhhcCCccc
Q 030333           91 NEIFECMNCGRSIVAGRFAPHLEKCMGKGRKA  122 (179)
Q Consensus        91 ~~~~~C~nC~R~v~a~RfA~HLekCmg~gr~s  122 (179)
                      +++|+|+||+|+|+++|||||||||||+||+|
T Consensus         2 ~~~~~C~nC~R~v~a~RfA~HLekCmg~g~~~   33 (33)
T PF08209_consen    2 SPYVECPNCGRPVAASRFAPHLEKCMGRGRRR   33 (33)
T ss_dssp             S-EEE-TTTSSEEEGGGHHHHHHHHTCH----
T ss_pred             CCeEECCCCcCCcchhhhHHHHHHHHccCCCC
Confidence            67999999999999999999999999999864


No 3  
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.41  E-value=0.00093  Score=39.18  Aligned_cols=23  Identities=30%  Similarity=0.735  Sum_probs=21.6

Q ss_pred             eeeeCCCCCcccccccchhHHHh
Q 030333           93 IFECMNCGRSIVAGRFAPHLEKC  115 (179)
Q Consensus        93 ~~~C~nC~R~v~a~RfA~HLekC  115 (179)
                      .+.|+.|+|.+...|+.-|+..|
T Consensus         2 l~~C~~CgR~F~~~~l~~H~~~C   24 (25)
T PF13913_consen    2 LVPCPICGRKFNPDRLEKHEKIC   24 (25)
T ss_pred             CCcCCCCCCEECHHHHHHHHHhc
Confidence            57899999999999999999988


No 4  
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=95.53  E-value=0.0049  Score=36.56  Aligned_cols=25  Identities=24%  Similarity=0.662  Sum_probs=22.6

Q ss_pred             eeeeCCCCCcccccccchhHHHhhc
Q 030333           93 IFECMNCGRSIVAGRFAPHLEKCMG  117 (179)
Q Consensus        93 ~~~C~nC~R~v~a~RfA~HLekCmg  117 (179)
                      ++.||.|++.|....+-.||+.|+.
T Consensus         1 ~v~CPiC~~~v~~~~in~HLD~CL~   25 (26)
T smart00734        1 LVQCPVCFREVPENLINSHLDSCLX   25 (26)
T ss_pred             CCcCCCCcCcccHHHHHHHHHHhcc
Confidence            3689999999999999999999975


No 5  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=86.08  E-value=0.38  Score=48.54  Aligned_cols=66  Identities=23%  Similarity=0.324  Sum_probs=44.1

Q ss_pred             CceeeeCCCCCccc-ccccchhHH--HhhcCCcccchhhhhhhh-hhhcccCCCCCCCCCCCCCCCCCCC
Q 030333           91 NEIFECMNCGRSIV-AGRFAPHLE--KCMGKGRKARLKVTRSAT-AAQNRYTRGSPGSSYSSYSNSTGMN  156 (179)
Q Consensus        91 ~~~~~C~nC~R~v~-a~RfA~HLe--kCmg~gr~sr~~a~rs~~-a~~~~~~~~~~~~s~spy~~~~~~n  156 (179)
                      -+-|+|+||++-++ .+-|--|+.  ||.+|+-.-.|..+---| -+...+.+.+|+++++||.----+|
T Consensus       307 EKPfeCpnCkKRFSHSGSySSHmSSKKCIsli~vngr~R~~lKt~~~Sp~saSsSp~~s~~pq~r~klen  376 (1007)
T KOG3623|consen  307 EKPFECPNCKKRFSHSGSYSSHMSSKKCISLILVNGRNRALLKTLEKSPGSASSSPRRSPSPQGRGKLEN  376 (1007)
T ss_pred             CCCcCCcccccccccCCcccccccccchhhhhcccCcchhhhhhcccCCcccCCCCCCCCChhHhhhccC
Confidence            45699999998775 568999995  799886554432211111 1223445677899999988766666


No 6  
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=77.58  E-value=0.73  Score=38.80  Aligned_cols=26  Identities=19%  Similarity=0.349  Sum_probs=0.0

Q ss_pred             CceeeeCCCCCcccccccchhHHHhh
Q 030333           91 NEIFECMNCGRSIVAGRFAPHLEKCM  116 (179)
Q Consensus        91 ~~~~~C~nC~R~v~a~RfA~HLekCm  116 (179)
                      ..+..||.||..|.++.|.-||.-=|
T Consensus       166 ~~~~~cPitGe~IP~~e~~eHmRi~L  191 (229)
T PF12230_consen  166 EKMIICPITGEMIPADEMDEHMRIEL  191 (229)
T ss_dssp             --------------------------
T ss_pred             cccccccccccccccccccccccccc
Confidence            46789999999999999999996543


No 7  
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=73.74  E-value=1.2  Score=41.54  Aligned_cols=30  Identities=20%  Similarity=0.589  Sum_probs=26.9

Q ss_pred             CceeeeCCCCCcccccccchhHHH-hhcCCc
Q 030333           91 NEIFECMNCGRSIVAGRFAPHLEK-CMGKGR  120 (179)
Q Consensus        91 ~~~~~C~nC~R~v~a~RfA~HLek-Cmg~gr  120 (179)
                      ..++.||.|++.|.....-.||.. |+|.+.
T Consensus       179 d~~v~CPiC~~~~~~~~i~~Hld~~Cl~~~~  209 (397)
T TIGR00599       179 EGLVQCPICQQRMPEKAVERHLDSECLGSPS  209 (397)
T ss_pred             CCcccCCCcccccCHHHHHHHHhccCCCCCC
Confidence            457999999999999999999999 999754


No 8  
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=71.90  E-value=2.5  Score=24.96  Aligned_cols=11  Identities=45%  Similarity=0.984  Sum_probs=9.2

Q ss_pred             CCceeeeCCCC
Q 030333           90 ANEIFECMNCG  100 (179)
Q Consensus        90 ~~~~~~C~nC~  100 (179)
                      ....|.|||||
T Consensus        13 ~~v~f~CPnCG   23 (24)
T PF07754_consen   13 QAVPFPCPNCG   23 (24)
T ss_pred             cCceEeCCCCC
Confidence            35689999998


No 9  
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=71.50  E-value=1.6  Score=29.03  Aligned_cols=23  Identities=26%  Similarity=0.600  Sum_probs=20.3

Q ss_pred             eeeeCCCCCcccccccchhHHHh
Q 030333           93 IFECMNCGRSIVAGRFAPHLEKC  115 (179)
Q Consensus        93 ~~~C~nC~R~v~a~RfA~HLekC  115 (179)
                      .|.||-|++.+....+..|++.-
T Consensus         2 ~f~CP~C~~~~~~~~L~~H~~~~   24 (54)
T PF05605_consen    2 SFTCPYCGKGFSESSLVEHCEDE   24 (54)
T ss_pred             CcCCCCCCCccCHHHHHHHHHhH
Confidence            58999999999999999998773


No 10 
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=68.39  E-value=3.1  Score=38.32  Aligned_cols=29  Identities=17%  Similarity=0.641  Sum_probs=26.0

Q ss_pred             CCceeeeCCCCCcccccccchhHHHhhcC
Q 030333           90 ANEIFECMNCGRSIVAGRFAPHLEKCMGK  118 (179)
Q Consensus        90 ~~~~~~C~nC~R~v~a~RfA~HLekCmg~  118 (179)
                      .-+.++||.|..-|..+-.-+||+.||..
T Consensus       157 ~E~l~~CP~C~~~~P~~~i~~HLD~CL~~  185 (391)
T COG5432         157 REDLVHCPACSNLVPHNQINQHLDSCLNS  185 (391)
T ss_pred             HHhhhcCchhhccCchHHHHHHHHHHhcC
Confidence            35688999999999999999999999985


No 11 
>PF12647 RNHCP:  RNHCP domain;  InterPro: IPR024439 This domain is found in uncharacterised bacterial proteins. It is typically between 94 and 143 amino acids in length and has a conserved RNHCP sequence motif.
Probab=61.95  E-value=3.1  Score=31.80  Aligned_cols=27  Identities=30%  Similarity=0.801  Sum_probs=22.8

Q ss_pred             CceeeeCCCCCcc----cccccchhHHHhhc
Q 030333           91 NEIFECMNCGRSI----VAGRFAPHLEKCMG  117 (179)
Q Consensus        91 ~~~~~C~nC~R~v----~a~RfA~HLekCmg  117 (179)
                      +..|.|.+|++.|    ..+.+--|=..||-
T Consensus         2 ~~~F~C~~CG~~V~p~~~g~~~RNHCP~CL~   32 (92)
T PF12647_consen    2 NESFTCVHCGLTVSPLAAGSAHRNHCPSCLS   32 (92)
T ss_pred             CcccCccccCCCcccCCCCCCccCcCccccc
Confidence            3579999999999    66778889888986


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=57.95  E-value=5  Score=39.20  Aligned_cols=27  Identities=30%  Similarity=0.491  Sum_probs=24.2

Q ss_pred             CceeeeCCCCCcccccccchhHHHhhc
Q 030333           91 NEIFECMNCGRSIVAGRFAPHLEKCMG  117 (179)
Q Consensus        91 ~~~~~C~nC~R~v~a~RfA~HLekCmg  117 (179)
                      ...+.|+||++.|...-|.-|+..|+=
T Consensus       405 ~~~V~C~NC~~~i~l~~l~lHe~~C~r  431 (567)
T PLN03086        405 VDTVECRNCKHYIPSRSIALHEAYCSR  431 (567)
T ss_pred             CCeEECCCCCCccchhHHHHHHhhCCC
Confidence            346799999999999999999999973


No 13 
>PF12269 zf-CpG_bind_C:  CpG binding protein zinc finger C terminal domain;  InterPro: IPR022056  This domain family is found in eukaryotes, and is approximately 240 amino acids in length. This domain is the zinc finger domain of a CpG binding DNA methyltransferase protein. It contains a CxxC motif which forms the zinc finger and binds to DNA. 
Probab=53.51  E-value=55  Score=28.85  Aligned_cols=29  Identities=31%  Similarity=0.705  Sum_probs=26.0

Q ss_pred             CCceeeeCCCCCcccccccchhHHHhhcC
Q 030333           90 ANEIFECMNCGRSIVAGRFAPHLEKCMGK  118 (179)
Q Consensus        90 ~~~~~~C~nC~R~v~a~RfA~HLekCmg~  118 (179)
                      ......|..||-+|.+--+--|+|||..+
T Consensus        81 ~~~~~~Cv~Cg~~i~~~~a~kHmEkCf~K  109 (236)
T PF12269_consen   81 DDLSIYCVTCGHEIPSKKALKHMEKCFAK  109 (236)
T ss_pred             cceeeeeeeCCCcCCHHHHHHHHHHHHHH
Confidence            45578999999999999999999999874


No 14 
>COG4481 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=52.87  E-value=6.2  Score=27.99  Aligned_cols=18  Identities=33%  Similarity=0.851  Sum_probs=15.4

Q ss_pred             CceeeeCCCCCccccccc
Q 030333           91 NEIFECMNCGRSIVAGRF  108 (179)
Q Consensus        91 ~~~~~C~nC~R~v~a~Rf  108 (179)
                      ..-..|.||++.|...||
T Consensus        32 DIkikC~nC~h~vm~pR~   49 (60)
T COG4481          32 DIKIKCENCGHSVMMPRY   49 (60)
T ss_pred             cEEEEecCCCcEEEecHH
Confidence            346899999999999886


No 15 
>PF12209 SAC3:  Leucine permease transcriptional regulator helical domain;  InterPro: IPR024293 This domain is found in fungal proteins, including the nuclear mRNA export protein SAC3. It has been suggested this domain provides a scaffold within the yeast Sac3:Cdc31:Sus1:Thp1 (TREX-2) complex to integrate interactions between protein complexes to facilitate the coupling of transcription and mRNA export during gene expression [].; PDB: 3FWC_N 3FWB_B.
Probab=52.46  E-value=26  Score=25.69  Aligned_cols=27  Identities=11%  Similarity=0.255  Sum_probs=23.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhh
Q 030333           12 HSQLSSHFFEDLLDSIIVDVASECHRV   38 (179)
Q Consensus        12 l~~LA~~Iy~dLLddiIlDIv~EvHR~   38 (179)
                      ++.|++++|+.+|.+++-.+++|+.-.
T Consensus        39 I~sLs~ELy~AFi~E~~Y~~~leskAd   65 (79)
T PF12209_consen   39 IDSLSEELYDAFIHEQLYQIYLESKAD   65 (79)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            678999999999999999999886654


No 16 
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=51.85  E-value=5.1  Score=42.05  Aligned_cols=28  Identities=32%  Similarity=0.729  Sum_probs=24.9

Q ss_pred             eeeCCCCCcccccccchhH--HHhhcCCcc
Q 030333           94 FECMNCGRSIVAGRFAPHL--EKCMGKGRK  121 (179)
Q Consensus        94 ~~C~nC~R~v~a~RfA~HL--ekCmg~gr~  121 (179)
                      -.|||||-.|..-|.+-+|  |+||-....
T Consensus         9 ~~CpNCGG~isseRL~~glpCe~CLp~~~~   38 (1187)
T COG1110           9 SSCPNCGGDISSERLEKGLPCERCLPEDTE   38 (1187)
T ss_pred             ccCCCCCCcCcHHHHhcCCCchhccCCccc
Confidence            4799999999999999999  899987653


No 17 
>PRK14701 reverse gyrase; Provisional
Probab=51.42  E-value=5.6  Score=43.16  Aligned_cols=25  Identities=40%  Similarity=0.670  Sum_probs=23.0

Q ss_pred             eeeeCCCCCcccccccchhH--HHhhc
Q 030333           93 IFECMNCGRSIVAGRFAPHL--EKCMG  117 (179)
Q Consensus        93 ~~~C~nC~R~v~a~RfA~HL--ekCmg  117 (179)
                      ...||||+-.|..-|.+-.|  ++||-
T Consensus         6 ~~~cpnc~g~~~~~rl~~g~~c~~cl~   32 (1638)
T PRK14701          6 KEMCPNCGGDITDERLAEKGVCEKCLK   32 (1638)
T ss_pred             cccCCCCCCccchhHHhcCCCchhhcc
Confidence            45799999999999999999  99996


No 18 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=51.07  E-value=9.3  Score=25.56  Aligned_cols=12  Identities=58%  Similarity=1.107  Sum_probs=10.3

Q ss_pred             CceeeeCCCCCc
Q 030333           91 NEIFECMNCGRS  102 (179)
Q Consensus        91 ~~~~~C~nC~R~  102 (179)
                      ...+.||+|+|-
T Consensus        44 ~~i~~Cp~CgRi   55 (56)
T PF02591_consen   44 DEIVFCPNCGRI   55 (56)
T ss_pred             CCeEECcCCCcc
Confidence            568999999995


No 19 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=48.90  E-value=7.3  Score=24.42  Aligned_cols=24  Identities=25%  Similarity=0.552  Sum_probs=15.7

Q ss_pred             CCceeeeCCCCCccccc-----ccchhHH
Q 030333           90 ANEIFECMNCGRSIVAG-----RFAPHLE  113 (179)
Q Consensus        90 ~~~~~~C~nC~R~v~a~-----RfA~HLe  113 (179)
                      ......|.-|+..+...     ++-.||.
T Consensus        13 ~~~~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             CSS-EEETTTTEE-----SSTHHHHHHHH
T ss_pred             CcCeEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            45679999999999885     7888883


No 20 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=47.39  E-value=9.5  Score=22.11  Aligned_cols=17  Identities=41%  Similarity=0.940  Sum_probs=9.1

Q ss_pred             eeeCCCCCcccc-cccch
Q 030333           94 FECMNCGRSIVA-GRFAP  110 (179)
Q Consensus        94 ~~C~nC~R~v~a-~RfA~  110 (179)
                      ..||+|+..|.. .||-|
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~   20 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCP   20 (26)
T ss_pred             CCCcccCCcCCcccccCh
Confidence            357777776432 34444


No 21 
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=46.91  E-value=9.6  Score=26.67  Aligned_cols=23  Identities=30%  Similarity=0.804  Sum_probs=11.5

Q ss_pred             eeeeCCCCCcccc---cccchhH-HHh
Q 030333           93 IFECMNCGRSIVA---GRFAPHL-EKC  115 (179)
Q Consensus        93 ~~~C~nC~R~v~a---~RfA~HL-ekC  115 (179)
                      .+.||.|++++..   +.|.|-= +||
T Consensus         2 ~v~CP~C~k~~~~~~~n~~rPFCS~RC   28 (57)
T PF03884_consen    2 TVKCPICGKPVEWSPENPFRPFCSERC   28 (57)
T ss_dssp             EEE-TTT--EEE-SSSSS--SSSSHHH
T ss_pred             cccCCCCCCeecccCCCCcCCcccHhh
Confidence            4789999999887   5665542 345


No 22 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=46.51  E-value=9.7  Score=21.82  Aligned_cols=11  Identities=45%  Similarity=0.899  Sum_probs=9.0

Q ss_pred             eeCCCCCcccc
Q 030333           95 ECMNCGRSIVA  105 (179)
Q Consensus        95 ~C~nC~R~v~a  105 (179)
                      .||+|+.+|..
T Consensus         1 ~Cp~CG~~~~~   11 (23)
T PF13240_consen    1 YCPNCGAEIED   11 (23)
T ss_pred             CCcccCCCCCC
Confidence            49999999864


No 23 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=44.98  E-value=11  Score=29.92  Aligned_cols=24  Identities=38%  Similarity=0.768  Sum_probs=15.9

Q ss_pred             CceeeeCCCCCccc-ccccchhHHHhhcC
Q 030333           91 NEIFECMNCGRSIV-AGRFAPHLEKCMGK  118 (179)
Q Consensus        91 ~~~~~C~nC~R~v~-a~RfA~HLekCmg~  118 (179)
                      ...++||||+++-- .+|-    +.||-=
T Consensus        67 av~V~CP~C~K~TKmLGr~----D~CM~C   91 (114)
T PF11023_consen   67 AVQVECPNCGKQTKMLGRV----DACMHC   91 (114)
T ss_pred             ceeeECCCCCChHhhhchh----hccCcC
Confidence            45789999999752 2332    567754


No 24 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=44.83  E-value=14  Score=26.39  Aligned_cols=17  Identities=35%  Similarity=0.720  Sum_probs=12.7

Q ss_pred             CCCCCceeeeCCCCCcc
Q 030333           87 PAVANEIFECMNCGRSI  103 (179)
Q Consensus        87 ~~~~~~~~~C~nC~R~v  103 (179)
                      +.+....|.|||||..+
T Consensus        21 p~e~~v~F~CPnCGe~~   37 (61)
T COG2888          21 PGETAVKFPCPNCGEVE   37 (61)
T ss_pred             cCCceeEeeCCCCCcee
Confidence            44567789999999544


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=43.24  E-value=12  Score=20.17  Aligned_cols=11  Identities=36%  Similarity=1.077  Sum_probs=9.1

Q ss_pred             eeeCCCCCccc
Q 030333           94 FECMNCGRSIV  104 (179)
Q Consensus        94 ~~C~nC~R~v~  104 (179)
                      |.|+.|++...
T Consensus         1 y~C~~C~~~f~   11 (23)
T PF00096_consen    1 YKCPICGKSFS   11 (23)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCCCCCccC
Confidence            68999998764


No 26 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=41.90  E-value=12  Score=24.50  Aligned_cols=26  Identities=31%  Similarity=0.589  Sum_probs=20.8

Q ss_pred             ceeeeCC--CCCcccccccchhHH-Hhhc
Q 030333           92 EIFECMN--CGRSIVAGRFAPHLE-KCMG  117 (179)
Q Consensus        92 ~~~~C~n--C~R~v~a~RfA~HLe-kCmg  117 (179)
                      ..+.||+  |...|.-..+..|++ .|.-
T Consensus         8 ~~v~C~~~cc~~~i~r~~l~~H~~~~C~~   36 (60)
T PF02176_consen    8 RPVPCPNGCCNEMIPRKELDDHLENECPK   36 (60)
T ss_dssp             SEEE-TT--S-BEEECCCHHHHHHTTSTT
T ss_pred             CEeeCCCCCcccceeHHHHHHHHHccCCC
Confidence            3689999  888899999999999 7865


No 27 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=41.06  E-value=12  Score=22.17  Aligned_cols=17  Identities=35%  Similarity=1.042  Sum_probs=11.5

Q ss_pred             eeCCCCCcccc-cccchh
Q 030333           95 ECMNCGRSIVA-GRFAPH  111 (179)
Q Consensus        95 ~C~nC~R~v~a-~RfA~H  111 (179)
                      +||+|+..|.. .++-||
T Consensus         2 ~CP~C~~~V~~~~~~Cp~   19 (26)
T PF10571_consen    2 TCPECGAEVPESAKFCPH   19 (26)
T ss_pred             cCCCCcCCchhhcCcCCC
Confidence            59999998864 344443


No 28 
>PF05253 zf-U11-48K:  U11-48K-like CHHC zinc finger;  InterPro: IPR022776  This zinc binding domain [] has four conserved zinc chelating residues in a CHHC pattern. This domain is predicted to have an RNA-binding function []. ; PDB: 2VY5_A 2VY4_A.
Probab=39.91  E-value=22  Score=20.88  Aligned_cols=24  Identities=21%  Similarity=0.510  Sum_probs=16.9

Q ss_pred             eeeeCC-CCCcccccccchhHHHhh
Q 030333           93 IFECMN-CGRSIVAGRFAPHLEKCM  116 (179)
Q Consensus        93 ~~~C~n-C~R~v~a~RfA~HLekCm  116 (179)
                      ++.||. -.=.|...++.-||.+|-
T Consensus         2 ~v~CPyn~~H~v~~~~l~~Hi~~C~   26 (27)
T PF05253_consen    2 LVRCPYNPSHRVPASELQKHIKKCP   26 (27)
T ss_dssp             EEE-TTTSS-EEEGGGHHHHHHHHH
T ss_pred             ceeCCCCCCcCcCHHHHHHHHHHcC
Confidence            356663 344788999999999994


No 29 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=38.83  E-value=12  Score=24.09  Aligned_cols=12  Identities=33%  Similarity=0.711  Sum_probs=7.6

Q ss_pred             eeeeCCCCCccc
Q 030333           93 IFECMNCGRSIV  104 (179)
Q Consensus        93 ~~~C~nC~R~v~  104 (179)
                      .+.||+||-.+.
T Consensus        21 ~~~Cp~CG~~~~   32 (46)
T PRK00398         21 GVRCPYCGYRIL   32 (46)
T ss_pred             ceECCCCCCeEE
Confidence            567777776543


No 30 
>PF06107 DUF951:  Bacterial protein of unknown function (DUF951);  InterPro: IPR009296 This family consists of several short hypothetical bacterial proteins of unknown function.
Probab=38.33  E-value=16  Score=25.74  Aligned_cols=16  Identities=38%  Similarity=0.885  Sum_probs=14.0

Q ss_pred             eeeeCCCCCccccccc
Q 030333           93 IFECMNCGRSIVAGRF  108 (179)
Q Consensus        93 ~~~C~nC~R~v~a~Rf  108 (179)
                      -+.|..|+|.|-..|.
T Consensus        31 kikC~gCg~~imlpR~   46 (57)
T PF06107_consen   31 KIKCLGCGRQIMLPRS   46 (57)
T ss_pred             EEEECCCCCEEEEeHH
Confidence            5789999999998874


No 31 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=37.43  E-value=22  Score=25.22  Aligned_cols=13  Identities=38%  Similarity=0.766  Sum_probs=10.8

Q ss_pred             CCceeeeCCCCCc
Q 030333           90 ANEIFECMNCGRS  102 (179)
Q Consensus        90 ~~~~~~C~nC~R~  102 (179)
                      ....|.|||||..
T Consensus        22 ~~~~F~CPnCG~~   34 (59)
T PRK14890         22 KAVKFLCPNCGEV   34 (59)
T ss_pred             ccCEeeCCCCCCe
Confidence            3568999999986


No 32 
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=37.41  E-value=12  Score=30.34  Aligned_cols=29  Identities=24%  Similarity=0.541  Sum_probs=24.1

Q ss_pred             eeeeCCCCCcccccccchhHHHhhcCCccc
Q 030333           93 IFECMNCGRSIVAGRFAPHLEKCMGKGRKA  122 (179)
Q Consensus        93 ~~~C~nC~R~v~a~RfA~HLekCmg~gr~s  122 (179)
                      .+.|.+|+..+.... +.+|..|-.=|...
T Consensus       112 ~l~C~~Cg~~~~~~~-~~~l~~Cp~C~~~~  140 (146)
T PF07295_consen  112 TLVCENCGHEVELTH-PERLPPCPKCGHTE  140 (146)
T ss_pred             eEecccCCCEEEecC-CCcCCCCCCCCCCe
Confidence            699999999999985 88999987766543


No 33 
>TIGR01054 rgy reverse gyrase. Generally, these gyrases are encoded as a single polypeptide. An exception was found in Methanopyrus kandleri, where enzyme is split within the topoisomerase domain, yielding a heterodimer of gene products designated RgyB and RgyA.
Probab=36.11  E-value=12  Score=39.33  Aligned_cols=25  Identities=32%  Similarity=0.666  Sum_probs=22.8

Q ss_pred             eeeeCCCCCcccccccchhH--HHhhc
Q 030333           93 IFECMNCGRSIVAGRFAPHL--EKCMG  117 (179)
Q Consensus        93 ~~~C~nC~R~v~a~RfA~HL--ekCmg  117 (179)
                      ...|||||-.|..-|..-.|  +|||.
T Consensus         7 ~~~CPnCgg~i~~~rl~~~~~c~~Clp   33 (1171)
T TIGR01054         7 SNLCPNCGGEISSERLEKGLPCARCLP   33 (1171)
T ss_pred             cCCCCCCCCccchhHhhcCCCccccCc
Confidence            45799999999999999988  89997


No 34 
>PRK09401 reverse gyrase; Reviewed
Probab=35.70  E-value=13  Score=39.05  Aligned_cols=25  Identities=40%  Similarity=0.741  Sum_probs=21.3

Q ss_pred             eeeeCCCCCcccccccchhH--HHhhc
Q 030333           93 IFECMNCGRSIVAGRFAPHL--EKCMG  117 (179)
Q Consensus        93 ~~~C~nC~R~v~a~RfA~HL--ekCmg  117 (179)
                      ...|||||..|..-|..--|  ++||-
T Consensus         7 ~~~cpnc~g~i~~~rl~~g~~c~~cl~   33 (1176)
T PRK09401          7 KNSCPNCGGDISDERLEKGLPCEKCLP   33 (1176)
T ss_pred             cccCCCCCCcCcHhHHhcCCcChhhCC
Confidence            45799999999999988765  77997


No 35 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=35.22  E-value=15  Score=24.30  Aligned_cols=14  Identities=29%  Similarity=0.543  Sum_probs=7.9

Q ss_pred             eeCCCCCccccccc
Q 030333           95 ECMNCGRSIVAGRF  108 (179)
Q Consensus        95 ~C~nC~R~v~a~Rf  108 (179)
                      .||.|+|.+.-...
T Consensus        22 ~CPlC~r~l~~e~~   35 (54)
T PF04423_consen   22 CCPLCGRPLDEEHR   35 (54)
T ss_dssp             E-TTT--EE-HHHH
T ss_pred             cCCCCCCCCCHHHH
Confidence            89999999876554


No 36 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=33.88  E-value=22  Score=29.42  Aligned_cols=17  Identities=29%  Similarity=0.448  Sum_probs=12.9

Q ss_pred             CCCceeeeCCCCCcccc
Q 030333           89 VANEIFECMNCGRSIVA  105 (179)
Q Consensus        89 ~~~~~~~C~nC~R~v~a  105 (179)
                      ..+++|.||+|++.+..
T Consensus       113 ~~~~~Y~Cp~C~~rytf  129 (178)
T PRK06266        113 ENNMFFFCPNCHIRFTF  129 (178)
T ss_pred             cCCCEEECCCCCcEEeH
Confidence            45678999999976643


No 37 
>PF14353 CpXC:  CpXC protein
Probab=32.74  E-value=23  Score=26.93  Aligned_cols=13  Identities=31%  Similarity=0.812  Sum_probs=11.1

Q ss_pred             eeeeCCCCCcccc
Q 030333           93 IFECMNCGRSIVA  105 (179)
Q Consensus        93 ~~~C~nC~R~v~a  105 (179)
                      .++||+||..+..
T Consensus        38 ~~~CP~Cg~~~~~   50 (128)
T PF14353_consen   38 SFTCPSCGHKFRL   50 (128)
T ss_pred             EEECCCCCCceec
Confidence            6899999998754


No 38 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=32.30  E-value=25  Score=27.78  Aligned_cols=17  Identities=24%  Similarity=0.491  Sum_probs=12.9

Q ss_pred             CCceeeeCCCCCccccc
Q 030333           90 ANEIFECMNCGRSIVAG  106 (179)
Q Consensus        90 ~~~~~~C~nC~R~v~a~  106 (179)
                      .+..+.||+|+..+.+.
T Consensus        96 ~~~~Y~Cp~C~~~y~~~  112 (147)
T smart00531       96 NNAYYKCPNCQSKYTFL  112 (147)
T ss_pred             CCcEEECcCCCCEeeHH
Confidence            46688899998877753


No 39 
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=31.34  E-value=29  Score=24.19  Aligned_cols=17  Identities=24%  Similarity=0.456  Sum_probs=13.9

Q ss_pred             CceeeeCCCCCcccccc
Q 030333           91 NEIFECMNCGRSIVAGR  107 (179)
Q Consensus        91 ~~~~~C~nC~R~v~a~R  107 (179)
                      ..+..||+|++.|+.-+
T Consensus        56 d~~H~Cp~C~~~lg~~~   72 (73)
T PF10601_consen   56 DVYHYCPNCGAFLGTYK   72 (73)
T ss_pred             CceEECCCCCCEeEEEe
Confidence            56799999999987654


No 40 
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=30.73  E-value=20  Score=24.69  Aligned_cols=16  Identities=31%  Similarity=0.758  Sum_probs=12.4

Q ss_pred             CCceeeeCCCCCcccc
Q 030333           90 ANEIFECMNCGRSIVA  105 (179)
Q Consensus        90 ~~~~~~C~nC~R~v~a  105 (179)
                      ...|..||+|+-+...
T Consensus        10 ~~kY~~Cp~CGN~~vG   25 (49)
T PF12677_consen   10 SNKYCKCPKCGNDKVG   25 (49)
T ss_pred             hhhhccCcccCCcEee
Confidence            3569999999987644


No 41 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=30.46  E-value=28  Score=28.18  Aligned_cols=16  Identities=25%  Similarity=0.326  Sum_probs=11.8

Q ss_pred             CCCceeeeCCCCCccc
Q 030333           89 VANEIFECMNCGRSIV  104 (179)
Q Consensus        89 ~~~~~~~C~nC~R~v~  104 (179)
                      ..++++.||+|++.+.
T Consensus       105 ~~~~~Y~Cp~c~~r~t  120 (158)
T TIGR00373       105 TNNMFFICPNMCVRFT  120 (158)
T ss_pred             cCCCeEECCCCCcEee
Confidence            3567888999987653


No 42 
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning]
Probab=30.38  E-value=22  Score=32.02  Aligned_cols=27  Identities=30%  Similarity=0.837  Sum_probs=22.7

Q ss_pred             CCceeeeCCCCCcccccccchhHHHhhc
Q 030333           90 ANEIFECMNCGRSIVAGRFAPHLEKCMG  117 (179)
Q Consensus        90 ~~~~~~C~nC~R~v~a~RfA~HLekCmg  117 (179)
                      .+.+|.|+-|+..+--.-|--|. +||.
T Consensus        26 rn~~fSCIDC~k~F~~~sYknH~-kCIT   52 (276)
T KOG2186|consen   26 RNAYFSCIDCGKTFERVSYKNHT-KCIT   52 (276)
T ss_pred             cCCeeEEeecccccccchhhhhh-hhcc
Confidence            46899999999999888888886 6875


No 43 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=29.95  E-value=36  Score=20.69  Aligned_cols=14  Identities=29%  Similarity=0.562  Sum_probs=10.9

Q ss_pred             ceeeeCCCCCcccc
Q 030333           92 EIFECMNCGRSIVA  105 (179)
Q Consensus        92 ~~~~C~nC~R~v~a  105 (179)
                      ..+.|++|+..+-+
T Consensus        24 ~~v~C~~C~~~~~~   37 (38)
T TIGR02098        24 GKVRCGKCGHVWYA   37 (38)
T ss_pred             CEEECCCCCCEEEe
Confidence            36999999987643


No 44 
>KOG3940 consensus Uncharacterized conserved protein [Function unknown]
Probab=29.56  E-value=25  Score=32.61  Aligned_cols=33  Identities=24%  Similarity=0.523  Sum_probs=25.5

Q ss_pred             CCCCCceeeeCCCCCcccccccchhHHHhhcCC
Q 030333           87 PAVANEIFECMNCGRSIVAGRFAPHLEKCMGKG  119 (179)
Q Consensus        87 ~~~~~~~~~C~nC~R~v~a~RfA~HLekCmg~g  119 (179)
                      +.+...|..||.|+|...---.|-|+-||-.|.
T Consensus       316 gse~~s~~~Cp~cg~r~~~~~~ak~~~~c~~r~  348 (351)
T KOG3940|consen  316 GSENPSYVQCPHCGRRFNEQAAAKHIPKCVNRV  348 (351)
T ss_pred             CCCCCCcccCccccccchHHHHHhhcccccccc
Confidence            345666899999999877666678889997763


No 45 
>PRK02935 hypothetical protein; Provisional
Probab=28.74  E-value=30  Score=27.34  Aligned_cols=13  Identities=15%  Similarity=0.424  Sum_probs=10.1

Q ss_pred             CceeeeCCCCCcc
Q 030333           91 NEIFECMNCGRSI  103 (179)
Q Consensus        91 ~~~~~C~nC~R~v  103 (179)
                      ...++||+|+++.
T Consensus        68 avqV~CP~C~K~T   80 (110)
T PRK02935         68 AVQVICPSCEKPT   80 (110)
T ss_pred             ceeeECCCCCchh
Confidence            3468999999864


No 46 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=28.14  E-value=26  Score=24.60  Aligned_cols=13  Identities=31%  Similarity=0.713  Sum_probs=11.1

Q ss_pred             eeeCCCCCccccc
Q 030333           94 FECMNCGRSIVAG  106 (179)
Q Consensus        94 ~~C~nC~R~v~a~  106 (179)
                      -.|++||.+|...
T Consensus         4 kHC~~CG~~Ip~~   16 (59)
T PF09889_consen    4 KHCPVCGKPIPPD   16 (59)
T ss_pred             CcCCcCCCcCCcc
Confidence            4799999999865


No 47 
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=28.09  E-value=30  Score=24.66  Aligned_cols=25  Identities=24%  Similarity=0.736  Sum_probs=17.3

Q ss_pred             ceeeeCCCCCccc---ccccchhH-HHhh
Q 030333           92 EIFECMNCGRSIV---AGRFAPHL-EKCM  116 (179)
Q Consensus        92 ~~~~C~nC~R~v~---a~RfA~HL-ekCm  116 (179)
                      ..+.||.|+++|.   .+.|-|-= +||-
T Consensus         5 ~~v~CP~C~k~~~w~~~~~~rPFCS~RCk   33 (62)
T PRK00418          5 ITVNCPTCGKPVEWGEISPFRPFCSKRCQ   33 (62)
T ss_pred             ccccCCCCCCcccccCCCCcCCcccHHHH
Confidence            3578999999985   46676653 3353


No 48 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=26.91  E-value=26  Score=24.14  Aligned_cols=14  Identities=43%  Similarity=0.899  Sum_probs=11.0

Q ss_pred             eeeeCCCCCccccc
Q 030333           93 IFECMNCGRSIVAG  106 (179)
Q Consensus        93 ~~~C~nC~R~v~a~  106 (179)
                      .|+||.|+..|...
T Consensus         2 ~~~CP~CG~~iev~   15 (54)
T TIGR01206         2 QFECPDCGAEIELE   15 (54)
T ss_pred             ccCCCCCCCEEecC
Confidence            47899999988654


No 49 
>PF12773 DZR:  Double zinc ribbon
Probab=26.64  E-value=35  Score=21.77  Aligned_cols=12  Identities=25%  Similarity=0.600  Sum_probs=8.6

Q ss_pred             eeeeCCCCCccc
Q 030333           93 IFECMNCGRSIV  104 (179)
Q Consensus        93 ~~~C~nC~R~v~  104 (179)
                      .-.|++|+.++.
T Consensus        12 ~~fC~~CG~~l~   23 (50)
T PF12773_consen   12 AKFCPHCGTPLP   23 (50)
T ss_pred             ccCChhhcCChh
Confidence            356888887776


No 50 
>PF11113 Phage_head_chap:  Head assembly gene product;  InterPro: IPR021049  This head assembly protein is also refereed to as gene product 40 (Gp40). A specific gp20-gp40 membrane insertion structure constitutes the T4 prohead assembly initiation complex [].
Probab=26.53  E-value=27  Score=24.57  Aligned_cols=12  Identities=50%  Similarity=1.099  Sum_probs=9.8

Q ss_pred             ccchhHHHhhcC
Q 030333          107 RFAPHLEKCMGK  118 (179)
Q Consensus       107 RfA~HLekCmg~  118 (179)
                      -.|||.++|+-+
T Consensus        43 el~phVe~ci~~   54 (56)
T PF11113_consen   43 ELAPHVEKCIQA   54 (56)
T ss_pred             HHHHHHHHHHhh
Confidence            368999999864


No 51 
>PF14577 SEO_C:  Sieve element occlusion C-terminus
Probab=26.31  E-value=33  Score=30.19  Aligned_cols=13  Identities=38%  Similarity=0.920  Sum_probs=11.3

Q ss_pred             ceeeeCCCCCccc
Q 030333           92 EIFECMNCGRSIV  104 (179)
Q Consensus        92 ~~~~C~nC~R~v~  104 (179)
                      ..+.||+|+|++-
T Consensus       213 e~i~CpeC~R~ME  225 (235)
T PF14577_consen  213 ETIVCPECGRPME  225 (235)
T ss_pred             ceeECCCCCCchh
Confidence            4689999999986


No 52 
>PRK01343 zinc-binding protein; Provisional
Probab=25.93  E-value=49  Score=23.26  Aligned_cols=19  Identities=21%  Similarity=0.481  Sum_probs=13.6

Q ss_pred             CceeeeCCCCCcccccccch
Q 030333           91 NEIFECMNCGRSIVAGRFAP  110 (179)
Q Consensus        91 ~~~~~C~nC~R~v~a~RfA~  110 (179)
                      .....||.|++++. ..|-|
T Consensus         7 ~p~~~CP~C~k~~~-~~~rP   25 (57)
T PRK01343          7 RPTRPCPECGKPST-REAYP   25 (57)
T ss_pred             CCCCcCCCCCCcCc-CCCCc
Confidence            45689999999976 33444


No 53 
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=25.84  E-value=34  Score=27.58  Aligned_cols=26  Identities=38%  Similarity=0.834  Sum_probs=21.8

Q ss_pred             CCceeeeCCCCCcccccccchhHHHhhcC
Q 030333           90 ANEIFECMNCGRSIVAGRFAPHLEKCMGK  118 (179)
Q Consensus        90 ~~~~~~C~nC~R~v~a~RfA~HLekCmg~  118 (179)
                      .+....|..||.+|-.+||.+   +|...
T Consensus        78 ~nl~~~CE~CG~~I~~Gr~C~---~C~~~  103 (137)
T TIGR03826        78 PNLGYPCERCGTSIREGRLCD---SCAGE  103 (137)
T ss_pred             CCCcCcccccCCcCCCCCccH---HHHHH
Confidence            467899999999999999985   67653


No 54 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=25.75  E-value=32  Score=19.65  Aligned_cols=11  Identities=36%  Similarity=1.071  Sum_probs=9.2

Q ss_pred             eeeeCCCCCcc
Q 030333           93 IFECMNCGRSI  103 (179)
Q Consensus        93 ~~~C~nC~R~v  103 (179)
                      .|.|+.|++..
T Consensus        14 ~~~C~~C~k~F   24 (26)
T PF13465_consen   14 PYKCPYCGKSF   24 (26)
T ss_dssp             SEEESSSSEEE
T ss_pred             CCCCCCCcCee
Confidence            49999999864


No 55 
>PF10609 ParA:  ParA/MinD ATPase like;  InterPro: IPR019591  This entry represents ATPases involved in plasmid partitioning []. It also contains cytosolic Fe-S cluster assembling factors, NBP35 and CFD1 which are required for biogenesis and export of both ribosomal subunits probably through assembling the ISCs in RLI1, a protein which performs rRNA processing and ribosome export [, , ].; PDB: 2PH1_A 3KB1_B.
Probab=24.61  E-value=34  Score=25.35  Aligned_cols=24  Identities=33%  Similarity=0.602  Sum_probs=12.9

Q ss_pred             ccceeCccCCCCCCceeeeCCCCCccc
Q 030333           78 VVDIFGQTHPAVANEIFECMNCGRSIV  104 (179)
Q Consensus        78 ~~DIfG~~~~~~~~~~~~C~nC~R~v~  104 (179)
                      ++.|-|-.   +.-.+|.||.|+..+.
T Consensus        53 ~vpilGvV---ENMs~~~Cp~Cg~~~~   76 (81)
T PF10609_consen   53 NVPILGVV---ENMSYFVCPHCGERIY   76 (81)
T ss_dssp             T-EEEEEE---ECT-EEE-TTT--EEE
T ss_pred             CCCcEEEE---ECCCccCCCCCCCeec
Confidence            45566654   3456999999998653


No 56 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=24.53  E-value=37  Score=26.01  Aligned_cols=11  Identities=55%  Similarity=1.364  Sum_probs=9.1

Q ss_pred             CceeeeCCCCC
Q 030333           91 NEIFECMNCGR  101 (179)
Q Consensus        91 ~~~~~C~nC~R  101 (179)
                      ..+|.||+|+-
T Consensus        19 pt~f~CP~Cge   29 (99)
T PRK14892         19 PKIFECPRCGK   29 (99)
T ss_pred             CcEeECCCCCC
Confidence            35899999994


No 57 
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=23.91  E-value=33  Score=22.90  Aligned_cols=15  Identities=40%  Similarity=1.001  Sum_probs=10.0

Q ss_pred             eeeCCCCC-ccccccc
Q 030333           94 FECMNCGR-SIVAGRF  108 (179)
Q Consensus        94 ~~C~nC~R-~v~a~Rf  108 (179)
                      +.|.+|++ +|...||
T Consensus         1 y~Cd~C~~~pI~G~R~   16 (48)
T cd02341           1 FKCDSCGIEPIPGTRY   16 (48)
T ss_pred             CCCCCCCCCccccceE
Confidence            35777776 6766666


No 58 
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=23.03  E-value=65  Score=30.87  Aligned_cols=13  Identities=46%  Similarity=1.043  Sum_probs=10.4

Q ss_pred             ceeeeCCCCCccc
Q 030333           92 EIFECMNCGRSIV  104 (179)
Q Consensus        92 ~~~~C~nC~R~v~  104 (179)
                      ..|.|.+|+-.|-
T Consensus       152 ~~F~C~~C~gelv  164 (436)
T KOG2593|consen  152 GEFHCENCGGELV  164 (436)
T ss_pred             ceEEEecCCCchh
Confidence            4799999987764


No 59 
>PF05304 DUF728:  Protein of unknown function (DUF728);  InterPro: IPR007968 This entry is represented by the Tobacco rattle virus, 16kDa protein; it is a family of uncharacterised viral proteins.
Probab=22.74  E-value=46  Score=25.86  Aligned_cols=26  Identities=42%  Similarity=0.621  Sum_probs=18.2

Q ss_pred             eeeeCCCCCccccccc-----------chhHHHhhcC
Q 030333           93 IFECMNCGRSIVAGRF-----------APHLEKCMGK  118 (179)
Q Consensus        93 ~~~C~nC~R~v~a~Rf-----------A~HLekCmg~  118 (179)
                      -++|.|||--+++.--           -.|||||-..
T Consensus        39 kC~~~NCGWf~~i~v~~~~~eVY~CCg~~HL~Kc~s~   75 (103)
T PF05304_consen   39 KCECNNCGWFPAISVNDDTFEVYFCCGMKHLEKCRSK   75 (103)
T ss_pred             hhhccCCCceEEEEEeccEEeeeeecCHHHHHHHhcC
Confidence            4788888876655432           2699999854


No 60 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=22.67  E-value=44  Score=17.18  Aligned_cols=20  Identities=30%  Similarity=0.796  Sum_probs=10.8

Q ss_pred             eeeCCCCCccc-ccccchhHH
Q 030333           94 FECMNCGRSIV-AGRFAPHLE  113 (179)
Q Consensus        94 ~~C~nC~R~v~-a~RfA~HLe  113 (179)
                      |.|+.|+.... ...+..|+.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~   21 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMR   21 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHH
Confidence            67999998654 334445544


No 61 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=22.06  E-value=40  Score=21.79  Aligned_cols=14  Identities=36%  Similarity=0.726  Sum_probs=7.5

Q ss_pred             eeCCCCCccccccc
Q 030333           95 ECMNCGRSIVAGRF  108 (179)
Q Consensus        95 ~C~nC~R~v~a~Rf  108 (179)
                      .|..|+++|...||
T Consensus         2 ~Cd~C~~~i~G~ry   15 (43)
T cd02340           2 ICDGCQGPIVGVRY   15 (43)
T ss_pred             CCCCCCCcCcCCeE
Confidence            35555555555554


No 62 
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=22.01  E-value=36  Score=29.95  Aligned_cols=14  Identities=43%  Similarity=0.883  Sum_probs=11.5

Q ss_pred             CCceeeeCCCCCcc
Q 030333           90 ANEIFECMNCGRSI  103 (179)
Q Consensus        90 ~~~~~~C~nC~R~v  103 (179)
                      ....+.||.|||-+
T Consensus       218 ~d~iv~CP~CgRIL  231 (239)
T COG1579         218 KDEIVFCPYCGRIL  231 (239)
T ss_pred             CCCCccCCccchHH
Confidence            56789999999954


No 63 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=21.93  E-value=53  Score=20.06  Aligned_cols=23  Identities=22%  Similarity=0.866  Sum_probs=16.1

Q ss_pred             eeeCCCCCcccccccchhHHHhhc
Q 030333           94 FECMNCGRSIVAGRFAPHLEKCMG  117 (179)
Q Consensus        94 ~~C~nC~R~v~a~RfA~HLekCmg  117 (179)
                      |.|..|+..+...-|..|- +|+.
T Consensus         1 ~sCiDC~~~F~~~~y~~Ht-~CIt   23 (28)
T PF08790_consen    1 FSCIDCSKDFDGDSYKSHT-SCIT   23 (28)
T ss_dssp             EEETTTTEEEEGGGTTT------S
T ss_pred             CeeecCCCCcCcCCcCCCC-cccC
Confidence            6899999999999999995 4553


No 64 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=21.76  E-value=41  Score=22.42  Aligned_cols=12  Identities=33%  Similarity=0.647  Sum_probs=10.0

Q ss_pred             eeeeCCCCCccc
Q 030333           93 IFECMNCGRSIV  104 (179)
Q Consensus        93 ~~~C~nC~R~v~  104 (179)
                      .-.|+.|+|++.
T Consensus         8 ~K~C~~C~rpf~   19 (42)
T PF10013_consen    8 SKICPVCGRPFT   19 (42)
T ss_pred             CCcCcccCCcch
Confidence            457999999985


No 65 
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=21.59  E-value=57  Score=23.73  Aligned_cols=14  Identities=21%  Similarity=0.897  Sum_probs=10.2

Q ss_pred             CceeeeCCCCCccc
Q 030333           91 NEIFECMNCGRSIV  104 (179)
Q Consensus        91 ~~~~~C~nC~R~v~  104 (179)
                      +..+.|+.|++-++
T Consensus        36 st~V~C~~CG~~l~   49 (67)
T COG2051          36 STVVTCLICGTTLA   49 (67)
T ss_pred             ceEEEecccccEEE
Confidence            45678888888765


No 66 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=21.58  E-value=45  Score=21.08  Aligned_cols=10  Identities=40%  Similarity=1.032  Sum_probs=6.5

Q ss_pred             eeeCCCCCcc
Q 030333           94 FECMNCGRSI  103 (179)
Q Consensus        94 ~~C~nC~R~v  103 (179)
                      +.||+|+..-
T Consensus         1 m~Cp~Cg~~~   10 (43)
T PF08271_consen    1 MKCPNCGSKE   10 (43)
T ss_dssp             ESBTTTSSSE
T ss_pred             CCCcCCcCCc
Confidence            4677777653


No 67 
>PF03847 TFIID_20kDa:  Transcription initiation factor TFIID subunit A;  InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [].; GO: 0006352 transcription initiation, DNA-dependent, 0005669 transcription factor TFIID complex; PDB: 1H3O_B.
Probab=21.42  E-value=2.1e+02  Score=20.30  Aligned_cols=34  Identities=24%  Similarity=0.255  Sum_probs=19.5

Q ss_pred             CCcchHHHHHHHHHHHHHHHHHHHHHHHhhhhhh
Q 030333            7 DNMSAHSQLSSHFFEDLLDSIIVDVASECHRVAR   40 (179)
Q Consensus         7 d~~s~l~~LA~~Iy~dLLddiIlDIv~EvHR~~K   40 (179)
                      |....++.-+++++-+|.|+.|-+++-..=+.+|
T Consensus        13 Dp~~~ld~~vee~Ll~laddFv~~v~~~ac~lAK   46 (68)
T PF03847_consen   13 DPNEKLDPDVEELLLELADDFVDDVVSFACRLAK   46 (68)
T ss_dssp             -SS----HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            4555666667777777777777777665555555


No 68 
>PF11687 DUF3284:  Domain of unknown function (DUF3284);  InterPro: IPR021701  This family of proteins with unknown function appears to be restricted to Firmicutes. 
Probab=20.86  E-value=96  Score=23.76  Aligned_cols=23  Identities=26%  Similarity=0.587  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhh
Q 030333           16 SSHFFEDLLDSIIVDVASECHRV   38 (179)
Q Consensus        16 A~~Iy~dLLddiIlDIv~EvHR~   38 (179)
                      |.+||+-|+++++.||-..+.+.
T Consensus        11 a~~ff~~l~~s~~~DI~~~tgk~   33 (120)
T PF11687_consen   11 AEEFFDYLIDSLLYDIKQATGKK   33 (120)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCCC
Confidence            68999999999999998877764


No 69 
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=20.42  E-value=58  Score=22.34  Aligned_cols=16  Identities=25%  Similarity=0.384  Sum_probs=12.9

Q ss_pred             CceeeeCCCCCccccc
Q 030333           91 NEIFECMNCGRSIVAG  106 (179)
Q Consensus        91 ~~~~~C~nC~R~v~a~  106 (179)
                      ..+..||+|++.|+.-
T Consensus        50 d~~H~Cp~C~~~lg~~   65 (67)
T smart00714       50 DVNHYCPNCGAFLGTY   65 (67)
T ss_pred             CccEECCCCCCEeEEe
Confidence            5579999999988753


No 70 
>COG5248 TAF19 Transcription initiation factor TFIID, subunit TAF13 [Transcription]
Probab=20.04  E-value=1.8e+02  Score=23.33  Aligned_cols=33  Identities=9%  Similarity=0.236  Sum_probs=24.6

Q ss_pred             CCcchHHHHHHHHHHHHHHHHHHHHHHHhhhhhh
Q 030333            7 DNMSAHSQLSSHFFEDLLDSIIVDVASECHRVAR   40 (179)
Q Consensus         7 d~~s~l~~LA~~Iy~dLLddiIlDIv~EvHR~~K   40 (179)
                      |.+.++-. +-+.+++++-+.+.++|.+.|+.+.
T Consensus        24 Dvv~P~~d-t~~~L~e~V~dY~~~~ctna~~~Aq   56 (126)
T COG5248          24 DVVAPRYD-TAEALHEYVLDYMSILCTNAHNMAQ   56 (126)
T ss_pred             CCCCcchh-HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444444 4567888888999999999999764


Done!