BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030342
         (179 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3SMV|A Chain A, X-Ray Crystal Structure Of L-Azetidine-2-Carboxylate
           Hydrolase
          Length = 240

 Score = 36.2 bits (82), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 56/138 (40%), Gaps = 24/138 (17%)

Query: 46  EIEAFKAPSYASPECRIDLGSSSKCNNKISAMRTPTNKATEE--RVVNRRESPHSTTPEK 103
           ++  FKA ++      ID  +      +  A RT     ++E   V  R ESP  T    
Sbjct: 2   QLTDFKALTFDCYGTLIDWETGIVNALQPLAKRTGKTFTSDELLEVFGRNESPQQT---- 57

Query: 104 RQRVPSA-YNQFIKEEIQRIKAN---NPDISHREAFSTAAKNWAHFPHI---------HF 150
               P A Y   ++    RI       PD + RE F T+ KNW  FP           H+
Sbjct: 58  --ETPGALYQDILRAVYDRIAKEWGLEPDAAEREEFGTSVKNWPAFPDTVEALQYLKKHY 115

Query: 151 GLMLEAN---NQPKLDDA 165
            L++ +N   N+ KL +A
Sbjct: 116 KLVILSNIDRNEFKLSNA 133


>pdb|3TQ6|A Chain A, Crystal Structure Of Human Mitochondrial Transcription
           Factor A, Tfam Or Mttfa, Bound To The Light Strand
           Promoter Lsp
 pdb|3TQ6|B Chain B, Crystal Structure Of Human Mitochondrial Transcription
           Factor A, Tfam Or Mttfa, Bound To The Light Strand
           Promoter Lsp
          Length = 214

 Score = 29.6 bits (65), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 109 SAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFP 146
           S+Y +F KE++   KA NPD    E     A+ W   P
Sbjct: 15  SSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELP 52


>pdb|3TMM|A Chain A, Tfam Imposes A U-Turn On Mitochondrial Dna
          Length = 238

 Score = 29.6 bits (65), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 109 SAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFP 146
           S+Y +F KE++   KA NPD    E     A+ W   P
Sbjct: 47  SSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELP 84


>pdb|3C0T|A Chain A, Structure Of The Schizosaccharomyces Pombe Mediator
           Subcomplex Med8c18
          Length = 207

 Score = 28.1 bits (61), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 130 SHREAFSTAAKNWAHFPHIHFGLMLEANNQPKLDDASGNRLMSRTALRN 178
           SH E  +  +KN        + + LE N++PK +D  G R ++R  L N
Sbjct: 64  SHDETDTEWSKN------TQWSMYLEGNSEPKREDKCGIRPVNRAKLTN 106


>pdb|4H63|R Chain R, Structure Of The Schizosaccharomyces Pombe Mediator Head
           Module
          Length = 209

 Score = 28.1 bits (61), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 130 SHREAFSTAAKNWAHFPHIHFGLMLEANNQPKLDDASGNRLMSRTALRN 178
           SH E  +  +KN        + + LE N++PK +D  G R ++R  L N
Sbjct: 66  SHDETDTEWSKN------TQWSMYLEGNSEPKREDKCGIRPVNRAKLTN 108


>pdb|2PCD|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|2PCD|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|2PCD|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|2PCD|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|2PCD|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|2PCD|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase From
           Pseudomonas Aeruginosa At 2.15 Angstroms Resolution
 pdb|3PCF|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCF|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCF|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCF|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCF|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCF|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Fluro-4- Hydroxybenzoate
 pdb|3PCH|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCH|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCH|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCH|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCH|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCH|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Chloro- 4-Hydroxybenzoate
 pdb|3PCL|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCL|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCL|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCL|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCL|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCL|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide And Cyanide
 pdb|3PCM|A Chain A, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCM|B Chain B, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCM|C Chain C, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCM|D Chain D, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCM|E Chain E, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCM|F Chain F, Structure Of Protocatechuate 3,4-dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-oxide And Cyanide
 pdb|3PCA|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCA|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCA|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCA|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCA|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCA|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxybenzoate
 pdb|3PCI|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCI|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCI|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCI|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCI|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCI|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3-Iodo-4- Hydroxybenzoate
 pdb|3PCJ|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCJ|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCJ|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCJ|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCJ|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCJ|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 2- Hydroxyisonicotinic Acid N-Oxide
 pdb|3PCK|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCK|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCK|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCK|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCK|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCK|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 6- Hydroxynicotinic Acid N-Oxide
 pdb|3PCN|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCN|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCN|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCN|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCN|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCN|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3,4- Dihydroxyphenylacetate
 pdb|3PCB|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCB|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCB|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCB|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCB|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCB|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxybenzoate
 pdb|3PCC|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCC|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCC|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCC|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCC|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCC|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 4- Hydroxybenzoate
 pdb|3PCD|A Chain A, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCD|B Chain B, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCD|C Chain C, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCD|D Chain D, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCD|E Chain E, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCD|F Chain F, Protocatechuate 3,4-Dioxygenase Y447h Mutant
 pdb|3PCE|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCE|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCE|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCE|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCE|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCE|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With 3- Hydroxyphenylacetate
 pdb|3PCG|A Chain A, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|3PCG|B Chain B, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|3PCG|C Chain C, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|3PCG|D Chain D, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|3PCG|E Chain E, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|3PCG|F Chain F, Structure Of Protocatechuate 3,4-Dioxygenase Complexed
           With The Inhibitor 4-Hydroxyphenylacetate
 pdb|1YKK|A Chain A, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKK|C Chain C, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKK|E Chain E, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKK|G Chain G, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKK|I Chain I, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKK|K Chain K, Protocatechuate 3,4-dioxygenase Y408c Mutant
 pdb|1YKL|A Chain A, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKL|C Chain C, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKL|E Chain E, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKL|G Chain G, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKL|I Chain I, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKL|K Chain K, Protocatechuate 3,4-Dioxygenase Y408c Mutant Bound To Dhb
 pdb|1YKM|A Chain A, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKM|C Chain C, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKM|E Chain E, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKM|G Chain G, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKM|I Chain I, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKM|K Chain K, Protocatechuate 3,4-dioxygenase Y408e Mutant
 pdb|1YKN|A Chain A, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKN|C Chain C, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKN|E Chain E, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKN|G Chain G, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKN|I Chain I, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKN|K Chain K, Protocatechuate 3,4-Dioxygenase Y408e Mutant Bound To Dhb
 pdb|1YKO|A Chain A, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKO|C Chain C, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKO|E Chain E, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKO|G Chain G, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKO|I Chain I, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKO|K Chain K, Protocatechuate 3,4-Dioxygenase Y408h Mutant
 pdb|1YKP|A Chain A, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|1YKP|C Chain C, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|1YKP|E Chain E, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|1YKP|G Chain G, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|1YKP|I Chain I, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|1YKP|K Chain K, Protocatechuate 3,4-Dioxygenase Y408h Mutant Bound To Dhb
 pdb|3LMX|A Chain A, Tyrosine 447 Of Protocatechuate 34,-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LMX|B Chain B, Tyrosine 447 Of Protocatechuate 34,-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LMX|C Chain C, Tyrosine 447 Of Protocatechuate 34,-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|A Chain A, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|B Chain B, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|C Chain C, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|D Chain D, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|E Chain E, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LKT|F Chain F, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LXV|A Chain A, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LXV|B Chain B, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3LXV|C Chain C, Tyrosine 447 Of Protocatechuate 3,4-Dioxygenase Controls
           Efficient Progress Through Catalysis
 pdb|3MFL|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MFL|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MFL|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI1|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI1|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI1|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|D Chain D, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|E Chain E, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MI5|F Chain F, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV4|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV4|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV4|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV6|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV6|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3MV6|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T63|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T63|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T63|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T67|A Chain A, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T67|B Chain B, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
 pdb|3T67|C Chain C, Axial Ligand Swapping In Double Mutant Maintains
           Intradiol-Cleavage Chemistry In Protocatechuate
           3,4-Dioxygenase
          Length = 200

 Score = 27.7 bits (60), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 14/25 (56%)

Query: 146 PHIHFGLMLEANNQPKLDDASGNRL 170
           P++H GL LEA   P  D    NRL
Sbjct: 15  PYVHIGLALEAAGNPTRDQEIWNRL 39


>pdb|3TK7|A Chain A, 2.0 Angstrom Resolution Crystal Structure Of Transaldolase
           B (Tala) From Francisella Tularensis In Covalent Complex
           With Fructose 6- Phosphate
 pdb|3TK7|B Chain B, 2.0 Angstrom Resolution Crystal Structure Of Transaldolase
           B (Tala) From Francisella Tularensis In Covalent Complex
           With Fructose 6- Phosphate
 pdb|3TNO|A Chain A, 1.65 Angstrom Resolution Crystal Structure Of
           Transaldolase B (Tala) From Francisella Tularensis In
           Covalent Complex With Sedoheptulose-7- Phosphate
 pdb|3TNO|B Chain B, 1.65 Angstrom Resolution Crystal Structure Of
           Transaldolase B (Tala) From Francisella Tularensis In
           Covalent Complex With Sedoheptulose-7- Phosphate
 pdb|3UPB|A Chain A, 1.5 Angstrom Resolution Crystal Structure Of Transaldolase
           From Francisella Tularensis In Covalent Complex With
           Arabinose-5-Phosphate
 pdb|3UPB|B Chain B, 1.5 Angstrom Resolution Crystal Structure Of Transaldolase
           From Francisella Tularensis In Covalent Complex With
           Arabinose-5-Phosphate
 pdb|4E0C|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Transaldolase
           From Francisella Tularensis (Phosphate-Free)
 pdb|4E0C|B Chain B, 1.8 Angstrom Resolution Crystal Structure Of Transaldolase
           From Francisella Tularensis (Phosphate-Free)
          Length = 345

 Score = 27.3 bits (59), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 111 YNQFIKEEIQRIKANNPDISHRE 133
           Y+  + E I ++KANNPD++  +
Sbjct: 73  YSNLVAETISKVKANNPDLNSDD 95


>pdb|3TE9|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of K135m Mutant
           Of Transaldolase B (Tala) From Francisella Tularensis In
           Complex With Fructose 6-Phosphate
 pdb|3TE9|B Chain B, 1.8 Angstrom Resolution Crystal Structure Of K135m Mutant
           Of Transaldolase B (Tala) From Francisella Tularensis In
           Complex With Fructose 6-Phosphate
 pdb|3TKF|A Chain A, 1.5 Angstrom Resolution Crystal Structure Of K135m Mutant
           Of Transaldolase B (Tala) From Francisella Tularensis In
           Complex With Sedoheptulose 7-Phosphate.
 pdb|3TKF|B Chain B, 1.5 Angstrom Resolution Crystal Structure Of K135m Mutant
           Of Transaldolase B (Tala) From Francisella Tularensis In
           Complex With Sedoheptulose 7-Phosphate
          Length = 345

 Score = 27.3 bits (59), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 111 YNQFIKEEIQRIKANNPDISHRE 133
           Y+  + E I ++KANNPD++  +
Sbjct: 73  YSNLVAETISKVKANNPDLNSDD 95


>pdb|3IGX|A Chain A, 1.85 Angstrom Resolution Crystal Structure Of
           Transaldolase B (Tala) From Francisella Tularensis.
 pdb|3IGX|B Chain B, 1.85 Angstrom Resolution Crystal Structure Of
           Transaldolase B (Tala) From Francisella Tularensis
          Length = 324

 Score = 27.3 bits (59), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 9/23 (39%), Positives = 16/23 (69%)

Query: 111 YNQFIKEEIQRIKANNPDISHRE 133
           Y+  + E I ++KANNPD++  +
Sbjct: 52  YSNLVAETISKVKANNPDLNSDD 74


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.126    0.362 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,634,264
Number of Sequences: 62578
Number of extensions: 162014
Number of successful extensions: 382
Number of sequences better than 100.0: 17
Number of HSP's better than 100.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 369
Number of HSP's gapped (non-prelim): 17
length of query: 179
length of database: 14,973,337
effective HSP length: 93
effective length of query: 86
effective length of database: 9,153,583
effective search space: 787208138
effective search space used: 787208138
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 48 (23.1 bits)