Citrus Sinensis ID: 030343

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MLNVEVRQIFKTRSKIVSYIRRFLDNLDFLEVETPMMNMIAGGAAARPFVTHHNDLNMKLYMRIAPELYLKELVVGGLDRVYEIGKQFRNEGIDLTHNPEFTTCEFYMAFADYNDLMELTEKMLSGMIKEITGSYKIKYHASGLDKDPIEIDFTPPFRSLNFIYSCKWYKIYHPGRSLL
cccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccHHHHHHcccHHHHHHHHcccccEEEcccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccccEEEEcccccccCCHHHHHHHHcccccccccc
**NVEVRQIFKTRSKIVSYIRRFLDNLDFLEVETPMMNMIAGGAAARPFVTHHNDLNMKLYMRIAPELYLKELVVGGLDRVYEIGKQFRNEGIDLTHNPEFTTCEFYMAFADYNDLMELTEKMLSGMIKEITGSYKIKYHASGLDKDPIEIDFTPPFRSLNFIYSCKWYKIYH**RSLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNVEVRQIFKTRSKIVSYIRRFLDNLDFLEVETPMMNMIAGGAAARPFVTHHNDLNMKLYMRIAPELYLKELVVGGLDRVYEIGKQFRNEGIDLTHNPEFTTCEFYMAFADYNDLMELTEKMLSGMIKEITGSYKIKYHASGLDKDPIEIDFTPPFRSLNFIYSCKWYKIYHPGRSLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lysine--tRNA ligase probableQ9ZPI1
Lysine--tRNA ligase Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.probableQ99MN1
Lysine--tRNA ligase Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.probableP37879

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BJU, chain A
Confidence level:very confident
Coverage over the Query: 2-171
View the alignment between query and template
View the model in PyMOL