BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 030356
(179 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3LS9|A Chain A, Crystal Structure Of Atrazine Chlorohydrolase Trzn From
Arthrobacter Aurescens Tc1 Complexed With Zinc
pdb|3LS9|B Chain B, Crystal Structure Of Atrazine Chlorohydrolase Trzn From
Arthrobacter Aurescens Tc1 Complexed With Zinc
Length = 456
Score = 26.6 bits (57), Expect = 9.0, Method: Compositional matrix adjust.
Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 5/61 (8%)
Query: 42 IMILSFIGPAIKSEWNLSPAQETLLTSVVFAGLLVGSYSWGFISDNYGRRKGLLGIAMLA 101
+ I I P ++ W L+P +E L AG+ VG + G S++ G G L +A LA
Sbjct: 291 VAIAHLIAPDLRMGWGLAPIREYL-----DAGITVGFGTTGSASNDGGNLLGDLRLAALA 345
Query: 102 S 102
Sbjct: 346 H 346
>pdb|3LSB|A Chain A, Crystal Structure Of The Mutant E241q Of Atrazine
Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
Complexed With Zinc And Ametrin
pdb|3LSB|B Chain B, Crystal Structure Of The Mutant E241q Of Atrazine
Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
Complexed With Zinc And Ametrin
pdb|3LSC|A Chain A, Crystal Structure Of The Mutant E241q Of Atrazine
Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
Complexed With Zinc And Atraton
pdb|3LSC|B Chain B, Crystal Structure Of The Mutant E241q Of Atrazine
Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
Complexed With Zinc And Atraton
Length = 456
Score = 26.6 bits (57), Expect = 9.1, Method: Compositional matrix adjust.
Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 5/61 (8%)
Query: 42 IMILSFIGPAIKSEWNLSPAQETLLTSVVFAGLLVGSYSWGFISDNYGRRKGLLGIAMLA 101
+ I I P ++ W L+P +E L AG+ VG + G S++ G G L +A LA
Sbjct: 291 VAIAHLIAPDLRMGWGLAPIREYL-----DAGITVGFGTTGSASNDGGNLLGDLRLAALA 345
Query: 102 S 102
Sbjct: 346 H 346
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.141 0.433
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,009,899
Number of Sequences: 62578
Number of extensions: 187638
Number of successful extensions: 397
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 395
Number of HSP's gapped (non-prelim): 4
length of query: 179
length of database: 14,973,337
effective HSP length: 93
effective length of query: 86
effective length of database: 9,153,583
effective search space: 787208138
effective search space used: 787208138
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 48 (23.1 bits)