BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030356
         (179 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LS9|A Chain A, Crystal Structure Of Atrazine Chlorohydrolase Trzn From
           Arthrobacter Aurescens Tc1 Complexed With Zinc
 pdb|3LS9|B Chain B, Crystal Structure Of Atrazine Chlorohydrolase Trzn From
           Arthrobacter Aurescens Tc1 Complexed With Zinc
          Length = 456

 Score = 26.6 bits (57), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 5/61 (8%)

Query: 42  IMILSFIGPAIKSEWNLSPAQETLLTSVVFAGLLVGSYSWGFISDNYGRRKGLLGIAMLA 101
           + I   I P ++  W L+P +E L      AG+ VG  + G  S++ G   G L +A LA
Sbjct: 291 VAIAHLIAPDLRMGWGLAPIREYL-----DAGITVGFGTTGSASNDGGNLLGDLRLAALA 345

Query: 102 S 102
            
Sbjct: 346 H 346


>pdb|3LSB|A Chain A, Crystal Structure Of The Mutant E241q Of Atrazine
           Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
           Complexed With Zinc And Ametrin
 pdb|3LSB|B Chain B, Crystal Structure Of The Mutant E241q Of Atrazine
           Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
           Complexed With Zinc And Ametrin
 pdb|3LSC|A Chain A, Crystal Structure Of The Mutant E241q Of Atrazine
           Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
           Complexed With Zinc And Atraton
 pdb|3LSC|B Chain B, Crystal Structure Of The Mutant E241q Of Atrazine
           Chlorohydrolase Trzn From Arthrobacter Aurescens Tc1
           Complexed With Zinc And Atraton
          Length = 456

 Score = 26.6 bits (57), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 5/61 (8%)

Query: 42  IMILSFIGPAIKSEWNLSPAQETLLTSVVFAGLLVGSYSWGFISDNYGRRKGLLGIAMLA 101
           + I   I P ++  W L+P +E L      AG+ VG  + G  S++ G   G L +A LA
Sbjct: 291 VAIAHLIAPDLRMGWGLAPIREYL-----DAGITVGFGTTGSASNDGGNLLGDLRLAALA 345

Query: 102 S 102
            
Sbjct: 346 H 346


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.141    0.433 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,009,899
Number of Sequences: 62578
Number of extensions: 187638
Number of successful extensions: 397
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 395
Number of HSP's gapped (non-prelim): 4
length of query: 179
length of database: 14,973,337
effective HSP length: 93
effective length of query: 86
effective length of database: 9,153,583
effective search space: 787208138
effective search space used: 787208138
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 48 (23.1 bits)