Query         030362
Match_columns 179
No_of_seqs    107 out of 517
Neff          6.7 
Searched_HMMs 46136
Date          Fri Mar 29 12:35:04 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030362.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030362hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2667 COPII vesicle protein  100.0 4.9E-59 1.1E-63  404.8  18.4  176    1-178   197-378 (379)
  2 PF07970 COPIIcoated_ERV:  Endo 100.0 3.6E-56 7.7E-61  366.2  17.1  159    1-159    56-222 (222)
  3 PF10399 UCR_Fe-S_N:  Ubiquitin  47.6     3.3 7.2E-05   25.3  -1.2   31  131-161     8-38  (41)
  4 PF01034 Syndecan:  Syndecan do  45.7     7.1 0.00015   26.2   0.1   10  167-176    34-43  (64)
  5 COG3765 WzzB Chain length dete  42.5      15 0.00033   32.4   1.7   46  119-169   299-344 (347)
  6 PF12421 DUF3672:  Fibronectin   41.8      20 0.00043   27.3   2.0   19    1-19     34-52  (136)
  7 PF05365 UCR_UQCRX_QCR9:  Ubiqu  33.4      26 0.00056   22.7   1.3   29  143-171    15-43  (55)
  8 PF04971 Lysis_S:  Lysis protei  33.3      14  0.0003   25.1  -0.1   28  145-172    36-64  (68)
  9 PF15631 Imm-NTF2-2:  NTF2 fold  32.7      34 0.00074   23.1   1.8   22    2-23     34-55  (66)
 10 PRK13718 conjugal transfer pro  26.1      68  0.0015   22.5   2.4   51  115-175    26-76  (84)
 11 KOG0910 Thioredoxin-like prote  24.8      65  0.0014   25.2   2.3   21   73-93    108-128 (150)
 12 PF11888 DUF3408:  Protein of u  24.0      55  0.0012   24.7   1.8   30  135-164    87-117 (136)
 13 PF10661 EssA:  WXG100 protein   22.4      32 0.00069   26.6   0.2   13  143-155   128-140 (145)
 14 KOG2014 SMT3/SUMO-activating c  22.2      26 0.00056   30.7  -0.4   11  143-153   286-296 (331)
 15 PF02468 PsbN:  Photosystem II   21.5      59  0.0013   20.1   1.2   18   47-64     25-42  (43)
 16 PF07413 Herpes_UL37_2:  Betahe  20.8      78  0.0017   27.2   2.3   35  129-163   229-266 (276)
 17 PRK13183 psbN photosystem II r  20.8      46   0.001   20.9   0.7   19   46-64     27-45  (46)
 18 CHL00020 psbN photosystem II p  20.6      44 0.00095   20.7   0.5   19   46-64     24-42  (43)

No 1  
>KOG2667 consensus COPII vesicle protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=100.00  E-value=4.9e-59  Score=404.81  Aligned_cols=176  Identities=44%  Similarity=0.769  Sum_probs=157.5

Q ss_pred             CEEEEEEEEeeeeeEEEEEEcCCc----eeeeeeeeCCCcccccceEEeEeeeCCCCCCCCCCCCCceeeecCCceeEEE
Q 030362            1 MQVYGVLDVQRVAGNFHISVHGLN----IYVAQMIFGGAKNVNVSHVIHDLSFGPKYPGIHNPLDGTVRMLHDTSGTFKY   76 (179)
Q Consensus         1 cri~G~l~VnkV~GnfhI~~~~~~----~~~~~~~~~~~~~~N~sH~I~~lsFG~~~~~~~~PLdg~~~~~~~~~~~~~Y   76 (179)
                      |||+|++.||||||||||++.+..    .+.++..  ..+++||||+||||||||++|+..|||||+..++.+...+|+|
T Consensus       197 CRi~G~l~VNKVaGnfHia~g~~~~~~~~h~hd~~--~~~~~n~SH~InhLSFG~~~p~~~nPLdG~~~~~~~~~~~~~Y  274 (379)
T KOG2667|consen  197 CRIYGQLEVNKVAGNFHIAPGKSSQHSNAHVHDLS--LLDNLNFSHRINHLSFGEYIPGIVNPLDGTNFIANEHLTTFQY  274 (379)
T ss_pred             eEEEEEEEEeeecceEEEccCCCccccccccchhh--hcccCCceEEEeeeccCCCCcccccCCCCccccccCCccceee
Confidence            999999999999999999964211    1111111  1147999999999999999999999999998888888899999


Q ss_pred             EEEEEEEEEEeecCceeeeeeeEEEEEEEeec-CCCC-CcceEEEEEEccceEEEEEeeeccHHHHHHhHhhhccceeee
Q 030362           77 YIKIVPTEYRYISKDVLPTNQFSVTEYFSTIN-EFDR-TWPAVYFLYDLSPITVTIKEERRSFLHLITRLCAVLGGTFAL  154 (179)
Q Consensus        77 flkvVPT~y~~~~~~~~~t~QYsvt~~~~~~~-~~~~-~~PgI~F~Yd~sPi~v~~~~~r~s~~~flt~lcaIiGGvftv  154 (179)
                      |+|||||.|.+.++.++.|||||||++.+... +.+. ++|||||+||+|||+|+++|+|.||++|||+|||||||+|||
T Consensus       275 f~KvVPT~y~~~~~~~~~T~QysVt~~~~~~~~~~~~~~~PGifF~YelSPl~V~v~E~r~sf~~Flt~lCAIiGGvftv  354 (379)
T KOG2667|consen  275 FLKVVPTVYKYKSGRVIDTNQYSVTEYEYVLHSHRAKSGIPGIFFKYELSPLMVKVTEERQSFSHFLTRLCAIIGGVFTV  354 (379)
T ss_pred             EEEEcceEEEeecCceecceeeeeeeeEEeccccccccCCCeEEEEEecCceEEEEEeccccHHHHHHHHHHHhcceeeh
Confidence            99999999999999999999999999998876 3333 899999999999999999999999999999999999999999


Q ss_pred             hhhhHHHHHHHHHHHcCCcccCcC
Q 030362          155 TGMLDRWMYRLLEALTKPSARSVL  178 (179)
Q Consensus       155 ~gliD~~~~~~~~~~~k~~~~~~~  178 (179)
                      ||+||++++++.++++++.+.+|+
T Consensus       355 agiid~~~~~~~~~i~~k~~~gk~  378 (379)
T KOG2667|consen  355 AGILDSLLYHILELIKGKIALGKY  378 (379)
T ss_pred             HHHHHHHHHHHHHHHhcchhhhcc
Confidence            999999999999999999998886


No 2  
>PF07970 COPIIcoated_ERV:  Endoplasmic reticulum vesicle transporter ;  InterPro: IPR012936 This domain occurs in many hypothetical proteins, and also two partially characterised proteins. One of these proteins, PTX1 Q96RQ1 from SWISSPROT, is a homeodomain-containing transcription factor involved in regulating all pituitary hormone genes []. This protein is down regulated in prostate carcinoma []. The other protein, ERGIC-32 Q969X5 from SWISSPROT, is involved in protein transport from the ER to the Golgi [].
Probab=100.00  E-value=3.6e-56  Score=366.18  Aligned_cols=159  Identities=41%  Similarity=0.739  Sum_probs=139.3

Q ss_pred             CEEEEEEEEeeeeeEEEEEEcCCc----eeeeeeeeCCCc-ccccceEEeEeeeCCCCCCCCCCCCCceee--ecCCcee
Q 030362            1 MQVYGVLDVQRVAGNFHISVHGLN----IYVAQMIFGGAK-NVNVSHVIHDLSFGPKYPGIHNPLDGTVRM--LHDTSGT   73 (179)
Q Consensus         1 cri~G~l~VnkV~GnfhI~~~~~~----~~~~~~~~~~~~-~~N~sH~I~~lsFG~~~~~~~~PLdg~~~~--~~~~~~~   73 (179)
                      |||+|++.||||+|||||+++...    .+.++....... .+|+||+|||||||+++|+..|||||+.++  .+....+
T Consensus        56 Cri~G~l~VnkV~Gnfhi~~g~~~~~~~~h~hd~~~~~~~~~~N~SH~I~~lsFG~~~~~~~~PLdg~~~~~~~~~~~~~  135 (222)
T PF07970_consen   56 CRIYGSLEVNKVPGNFHIAPGRSFQQDGGHIHDLSPFDDEPKFNFSHTINHLSFGEEIPGIVNPLDGTQKIVQTDNGNYM  135 (222)
T ss_pred             CEEEEEEEEEEEEEEEEEEecchhccCCcceeehhhhccccCCCCCeEEEEEEeccccccccccccCccccccCCCCcee
Confidence            999999999999999999986532    111111111122 799999999999999999999999999883  4667889


Q ss_pred             EEEEEEEEEEEEEeecCceeeeeeeEEEEEEEeecCCC-CCcceEEEEEEccceEEEEEeeeccHHHHHHhHhhhcccee
Q 030362           74 FKYYIKIVPTEYRYISKDVLPTNQFSVTEYFSTINEFD-RTWPAVYFLYDLSPITVTIKEERRSFLHLITRLCAVLGGTF  152 (179)
Q Consensus        74 ~~YflkvVPT~y~~~~~~~~~t~QYsvt~~~~~~~~~~-~~~PgI~F~Yd~sPi~v~~~~~r~s~~~flt~lcaIiGGvf  152 (179)
                      |+||||||||+|...++..++|||||+|++.+.+.... .++|||||+||||||+|+++++|+||+||||+|||||||+|
T Consensus       136 ~~YflkvVPT~y~~~~~~~~~t~qYsvt~~~~~~~~~~~~~~PGI~F~Yd~SPi~v~~~~~r~s~~~flt~lcaIiGGvf  215 (222)
T PF07970_consen  136 YQYFLKVVPTTYEDLDGFSIETYQYSVTEHSRPLNGGSSGGLPGIFFKYDFSPIMVVITEDRKSFLHFLTRLCAIIGGVF  215 (222)
T ss_pred             EEEEEEEeeeeeEeccccccccccccceeeeeeccCCCCCCCceEEEEEeceeEEEEEEEecCCHHHHHHHHHHHhchHh
Confidence            99999999999999988767999999999999987654 78999999999999999999999999999999999999999


Q ss_pred             eehhhhH
Q 030362          153 ALTGMLD  159 (179)
Q Consensus       153 tv~gliD  159 (179)
                      |++||||
T Consensus       216 tv~gliD  222 (222)
T PF07970_consen  216 TVAGLID  222 (222)
T ss_pred             eEEEecC
Confidence            9999998


No 3  
>PF10399 UCR_Fe-S_N:  Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal;  InterPro: IPR019470  This entry represents the TAT-signal region found in the iron-sulphur subunit of Ubiquinol-cytochrome C reductase (also known as the cytochrome bc1 complex). This enzymex is an oligomeric membrane protein complex that is a component of respiratory and photosynthetic electron transfer chains. It couples the transfer of electrons from ubiquinol to cytochrome c with the generation of a protein gradient across the membrane []. This entry is associated with IPR017941 from INTERPRO, IPR004192 from INTERPRO and IPR015248 from INTERPRO. ; GO: 0008121 ubiquinol-cytochrome-c reductase activity, 0055114 oxidation-reduction process; PDB: 1ZRT_R 2QJY_R 2FYN_L 2QJK_O 2QJP_I 2YIU_F.
Probab=47.63  E-value=3.3  Score=25.27  Aligned_cols=31  Identities=23%  Similarity=0.326  Sum_probs=23.5

Q ss_pred             EeeeccHHHHHHhHhhhccceeeehhhhHHH
Q 030362          131 KEERRSFLHLITRLCAVLGGTFALTGMLDRW  161 (179)
Q Consensus       131 ~~~r~s~~~flt~lcaIiGGvftv~gliD~~  161 (179)
                      ..+|+.|+...+...|.+|++.++.-++++|
T Consensus         8 ~~~RRdFL~~at~~~gavG~~~~a~Pfv~s~   38 (41)
T PF10399_consen    8 DPTRRDFLTIATSAVGAVGAAAAAWPFVSSM   38 (41)
T ss_dssp             --HHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            4567888888888889999888877777654


No 4  
>PF01034 Syndecan:  Syndecan domain;  InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ]. Structurally, these proteins consist of four separate domains:   A signal sequence; An extracellular domain (ectodomain) of variable length whose sequence is not evolutionary conserved in the various forms of syndecans. The ectodomain contains the sites of attachment of the heparan sulphate glycosaminoglycan side chains;  A transmembrane region;  A highly conserved cytoplasmic domain of about 30 to 35 residues, which could interact with cytoskeletal proteins.    The proteins known to belong to this family are:    Syndecan 1.  Syndecan 2 or fibroglycan.  Syndecan 3 or neuroglycan or N-syndecan.  Syndecan 4 or amphiglycan or ryudocan.  Drosophila syndecan.   Caenorhabditis elegans probable syndecan (F57C7.3).    Syndecan-4, a transmembrane heparan sulphate proteoglycan, is a coreceptor with integrins in cell adhesion. It has been suggested to form a ternary signalling complex with protein kinase Calpha and phosphatidylinositol 4,5-bisphosphate (PIP2). Structural studies have demonstrated that the cytoplasmic domain undergoes a conformational transition and forms a symmetric dimer in the presence of phospholipid activator PIP2, and whose overall structure in solution exhibits a twisted clamp shape having a cavity in the centre of dimeric interface. In addition, it has been observed that the syndecan-4 variable domain interacts, strongly, not only with fatty acyl groups but also the anionic head group of PIP2. These findings indicate that PIP2 promotes oligomerisation of the syndecan-4 cytoplasmic domain for transmembrane signalling and cell-matrix adhesion [, ].; GO: 0008092 cytoskeletal protein binding, 0016020 membrane; PDB: 1EJQ_B 1EJP_B 1YBO_C 1OBY_Q.
Probab=45.70  E-value=7.1  Score=26.19  Aligned_cols=10  Identities=20%  Similarity=0.122  Sum_probs=0.7

Q ss_pred             HHHcCCcccC
Q 030362          167 EALTKPSARS  176 (179)
Q Consensus       167 ~~~~k~~~~~  176 (179)
                      -.++|++|++
T Consensus        34 yR~rkkdEGS   43 (64)
T PF01034_consen   34 YRMRKKDEGS   43 (64)
T ss_dssp             ---S------
T ss_pred             HHHHhcCCCC
Confidence            3457777765


No 5  
>COG3765 WzzB Chain length determinant protein [Cell envelope biogenesis, outer membrane]
Probab=42.49  E-value=15  Score=32.42  Aligned_cols=46  Identities=17%  Similarity=0.247  Sum_probs=32.1

Q ss_pred             EEEEccceEEEEEeeeccHHHHHHhHhhhccceeeehhhhHHHHHHHHHHH
Q 030362          119 FLYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMYRLLEAL  169 (179)
Q Consensus       119 F~Yd~sPi~v~~~~~r~s~~~flt~lcaIiGGvftv~gliD~~~~~~~~~~  169 (179)
                      |+|+.+|..=+-+.  .|=-.+++-+.|+|||++.+...   ++.++.+..
T Consensus       299 yRYl~~P~~Pvkrd--~PrrA~ilil~~LiGgm~g~g~v---L~R~~lk~~  344 (347)
T COG3765         299 YRYLQKPTLPVKRD--SPRRAIILILGALIGGMLGAGVV---LLRNALKKY  344 (347)
T ss_pred             EEecCCCCCCCcCC--CcchHHHHHHHHHHHHHHHHHHH---HHHHHHHHh
Confidence            78888887644333  46678999999999999988763   444444443


No 6  
>PF12421 DUF3672:  Fibronectin type III protein ;  InterPro: IPR021034  This entry represents a region of bacterial and viral proteins that are typically between 126 and 146 amino acids in length. The signature is found at the C terminus in association with PF09327 from PFAM and PF00041 from PFAM. There are two completely conserved G residues that may be functionally important. Many of the proteins in this entry are annotated as fibronectin type III however there is little accompanying literature to confirm this. It is also found in Host specificity protein J from Enterobacteria phage lambda (Bacteriophage lambda).
Probab=41.79  E-value=20  Score=27.35  Aligned_cols=19  Identities=11%  Similarity=0.270  Sum_probs=17.2

Q ss_pred             CEEEEEEEEeeeeeEEEEE
Q 030362            1 MQVYGVLDVQRVAGNFHIS   19 (179)
Q Consensus         1 cri~G~l~VnkV~GnfhI~   19 (179)
                      |.+.|+++.+++-|++--+
T Consensus        34 ~~~~Gtv~A~~i~GDiv~~   52 (136)
T PF12421_consen   34 CTFKGTVYANKIIGDIVKA   52 (136)
T ss_pred             ceEEeEEEehhEecceeEE
Confidence            9999999999999997654


No 7  
>PF05365 UCR_UQCRX_QCR9:  Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like;  InterPro: IPR008027 The UQCRX/QCR9 protein is the 9/10 subunit of complex III, and is a protein of about 7 kDa. Deletion of QCR9 results in the inability of Saccharomyces cerevisiae to grow on a fermentable carbon source []. The protein is part of the mitchondrial respiratory chain. ; GO: 0008121 ubiquinol-cytochrome-c reductase activity, 0006122 mitochondrial electron transport, ubiquinol to cytochrome c, 0005740 mitochondrial envelope; PDB: 3CX5_T 2IBZ_I 1KYO_I 3CXH_T 1EZV_I 1P84_I 1KB9_I 3H1L_W 3L71_W 3L73_W ....
Probab=33.41  E-value=26  Score=22.69  Aligned_cols=29  Identities=14%  Similarity=0.362  Sum_probs=20.8

Q ss_pred             hHhhhccceeeehhhhHHHHHHHHHHHcC
Q 030362          143 RLCAVLGGTFALTGMLDRWMYRLLEALTK  171 (179)
Q Consensus       143 ~lcaIiGGvftv~gliD~~~~~~~~~~~k  171 (179)
                      =+.+|++|.|+.-..+|.....+-+.++|
T Consensus        15 y~~~i~~gaf~fe~~fd~~~d~~w~~~Nk   43 (55)
T PF05365_consen   15 YVLTIFAGAFFFERAFDSATDKIWDSINK   43 (55)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHhHHHHHHHHhccC
Confidence            45688889888888778777666555543


No 8  
>PF04971 Lysis_S:  Lysis protein S ;  InterPro: IPR007054 The lysis S protein is a cytotoxic protein forming holes in membranes causing cell lysis. The action of Lysis S is independent of the proportion of acidic phospholipids in the membrane [].
Probab=33.26  E-value=14  Score=25.13  Aligned_cols=28  Identities=29%  Similarity=0.517  Sum_probs=19.9

Q ss_pred             hhhcccee-eehhhhHHHHHHHHHHHcCC
Q 030362          145 CAVLGGTF-ALTGMLDRWMYRLLEALTKP  172 (179)
Q Consensus       145 caIiGGvf-tv~gliD~~~~~~~~~~~k~  172 (179)
                      .+|+||++ ++++++-.+.|+..+--+|.
T Consensus        36 IGvi~gi~~~~lt~ltN~YFK~k~drr~~   64 (68)
T PF04971_consen   36 IGVIGGIFFGLLTYLTNLYFKIKEDRRKA   64 (68)
T ss_pred             HHHHHHHHHHHHHHHhHhhhhhhHhhhHh
Confidence            47888876 78888888888765544333


No 9  
>PF15631 Imm-NTF2-2:  NTF2 fold immunity protein
Probab=32.74  E-value=34  Score=23.06  Aligned_cols=22  Identities=27%  Similarity=0.311  Sum_probs=17.6

Q ss_pred             EEEEEEEEeeeeeEEEEEEcCC
Q 030362            2 QVYGVLDVQRVAGNFHISVHGL   23 (179)
Q Consensus         2 ri~G~l~VnkV~GnfhI~~~~~   23 (179)
                      -|+|++.-+..-|++||.....
T Consensus        34 iV~Gtl~~~~~GGv~~I~I~K~   55 (66)
T PF15631_consen   34 IVEGTLPPGMLGGVFYIEIRKK   55 (66)
T ss_pred             EEEeecCCCccCCeEEEEEEcc
Confidence            3789998888899999987544


No 10 
>PRK13718 conjugal transfer protein TrbE; Provisional
Probab=26.11  E-value=68  Score=22.47  Aligned_cols=51  Identities=20%  Similarity=0.371  Sum_probs=27.0

Q ss_pred             ceEEEEEEccceEEEEEeeeccHHHHHHhHhhhccceeeehhhhHHHHHHHHHHHcCCccc
Q 030362          115 PAVYFLYDLSPITVTIKEERRSFLHLITRLCAVLGGTFALTGMLDRWMYRLLEALTKPSAR  175 (179)
Q Consensus       115 PgI~F~Yd~sPi~v~~~~~r~s~~~flt~lcaIiGGvftv~gliD~~~~~~~~~~~k~~~~  175 (179)
                      |.|++++|-    |+-+.....+..-++=+|+  |+++.+.    -++|.+...+++++++
T Consensus        26 PviywSWDt----VK~TTa~d~l~a~~iI~~~--gv~~~~l----y~ffs~Ltkl~~~d~~   76 (84)
T PRK13718         26 PVIYWSWDT----VKETTADDMLAAVFVILYS--GVLLFIL----YFFFSALTKLQKHDER   76 (84)
T ss_pred             ceEEEEehh----ccccchhHHHHHHHHHHHH--hHHHHHH----HHHHHHHHHHHhcccc
Confidence            999999993    4444444444333333322  4443333    4556666555555544


No 11 
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]
Probab=24.81  E-value=65  Score=25.21  Aligned_cols=21  Identities=24%  Similarity=0.331  Sum_probs=17.9

Q ss_pred             eEEEEEEEEEEEEEeecCcee
Q 030362           73 TFKYYIKIVPTEYRYISKDVL   93 (179)
Q Consensus        73 ~~~YflkvVPT~y~~~~~~~~   93 (179)
                      .-+|.++.|||.....+|++.
T Consensus       108 a~~Y~I~avPtvlvfknGe~~  128 (150)
T KOG0910|consen  108 AEDYEISAVPTVLVFKNGEKV  128 (150)
T ss_pred             HhhcceeeeeEEEEEECCEEe
Confidence            447999999999999888764


No 12 
>PF11888 DUF3408:  Protein of unknown function (DUF3408);  InterPro: IPR021823  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 128 to 160 amino acids in length. 
Probab=24.01  E-value=55  Score=24.71  Aligned_cols=30  Identities=20%  Similarity=0.480  Sum_probs=25.9

Q ss_pred             ccHHHHHHhHhhhcc-ceeeehhhhHHHHHH
Q 030362          135 RSFLHLITRLCAVLG-GTFALTGMLDRWMYR  164 (179)
Q Consensus       135 ~s~~~flt~lcaIiG-Gvftv~gliD~~~~~  164 (179)
                      ..+..=|.++..+|| +=.+++|+||.++-.
T Consensus        87 ~e~h~~l~~Iv~~ig~~~~si~~yidNIL~~  117 (136)
T PF11888_consen   87 RETHERLSRIVRVIGERKMSISGYIDNILRH  117 (136)
T ss_pred             HHHHHHHHHHHHHHCCCCCcHHHHHHHHHHH
Confidence            467788999999999 669999999999854


No 13 
>PF10661 EssA:  WXG100 protein secretion system (Wss), protein EssA;  InterPro: IPR018920  The Wss (WXG100 protein secretion system) in Staphylococcus aureus seems to be encoded by a locus of eight ORFs, called ess (eSAT-6 secretion system) []. This locus encodes, amongst several other proteins, EssA, a protein predicted to possess one transmembrane domain. Due to its predicted membrane location and its absolute requirement for WXG100 protein secretion, it has been speculated that EssA could form a secretion apparatus in conjunction with YukC and YukAB. Proteins homologous to EssA, YukC, EsaA and YukD were absent from mycobacteria [].   Members of this family are associated with type VII secretion of WXG100 family targets in the Firmicutes, but not in the Actinobacteria. This highly divergent protein family consists largely of a central region of highly polar low-complexity sequence containing occasional LF motifs in weak repeats about 17 residues in length, flanked by hydrophobic N- and C-terminal regions. 
Probab=22.39  E-value=32  Score=26.61  Aligned_cols=13  Identities=31%  Similarity=0.575  Sum_probs=6.1

Q ss_pred             hHhhhccceeeeh
Q 030362          143 RLCAVLGGTFALT  155 (179)
Q Consensus       143 ~lcaIiGGvftv~  155 (179)
                      .||+|.||+|+++
T Consensus       128 ~ll~i~~giy~~~  140 (145)
T PF10661_consen  128 ILLAICGGIYVVL  140 (145)
T ss_pred             HHHHHHHHHHHHH
Confidence            3344445555444


No 14 
>KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones]
Probab=22.24  E-value=26  Score=30.71  Aligned_cols=11  Identities=55%  Similarity=1.120  Sum_probs=8.9

Q ss_pred             hHhhhccceee
Q 030362          143 RLCAVLGGTFA  153 (179)
Q Consensus       143 ~lcaIiGGvft  153 (179)
                      =+||||||+.+
T Consensus       286 Pv~AvVGGiva  296 (331)
T KOG2014|consen  286 PVCAVVGGILA  296 (331)
T ss_pred             chhhhhhhHhH
Confidence            47999999863


No 15 
>PF02468 PsbN:  Photosystem II reaction centre N protein (psbN);  InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=21.48  E-value=59  Score=20.09  Aligned_cols=18  Identities=22%  Similarity=0.593  Sum_probs=14.7

Q ss_pred             eeeCCCCCCCCCCCCCce
Q 030362           47 LSFGPKYPGIHNPLDGTV   64 (179)
Q Consensus        47 lsFG~~~~~~~~PLdg~~   64 (179)
                      .+||++..++.+|.|.++
T Consensus        25 taFGppSk~LrDPfeeHe   42 (43)
T PF02468_consen   25 TAFGPPSKELRDPFEEHE   42 (43)
T ss_pred             heeCCCccccCCcccccC
Confidence            579998888999988763


No 16 
>PF07413 Herpes_UL37_2:  Betaherpesvirus immediate-early glycoprotein UL37;  InterPro: IPR010880 This family consists of several Betaherpesvirus immediate-early glycoprotein UL37 sequences. The human cytomegalovirus (HCMV) UL37 immediate-early regulatory protein is a type I integral membrane N-glycoprotein which traffics through the ER and the Golgi network [].
Probab=20.84  E-value=78  Score=27.19  Aligned_cols=35  Identities=17%  Similarity=0.281  Sum_probs=24.6

Q ss_pred             EEEeeeccHHHH---HHhHhhhccceeeehhhhHHHHH
Q 030362          129 TIKEERRSFLHL---ITRLCAVLGGTFALTGMLDRWMY  163 (179)
Q Consensus       129 ~~~~~r~s~~~f---lt~lcaIiGGvftv~gliD~~~~  163 (179)
                      .+..+...+.+.   ++++|++.||.|++.+++=-++-
T Consensus       229 ~~~~~~~~l~~~~~~~~g~~~v~~G~~~lL~LFc~l~~  266 (276)
T PF07413_consen  229 ILRVDYRALGHWLAALIGMFFVASGAFMLLSLFCCLSI  266 (276)
T ss_pred             EEecCCcchhhhhhhhhhhhhHHHHHHHHHHHHHHHHH
Confidence            344444555555   88999999999999976654443


No 17 
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=20.77  E-value=46  Score=20.85  Aligned_cols=19  Identities=26%  Similarity=0.560  Sum_probs=15.4

Q ss_pred             EeeeCCCCCCCCCCCCCce
Q 030362           46 DLSFGPKYPGIHNPLDGTV   64 (179)
Q Consensus        46 ~lsFG~~~~~~~~PLdg~~   64 (179)
                      .-+||++..++.+|.|.++
T Consensus        27 YtaFGppSk~LrDPFeeHe   45 (46)
T PRK13183         27 YTAFGPPSKELDDPFDDHE   45 (46)
T ss_pred             eeccCCcccccCCchhhcC
Confidence            4589999888999988763


No 18 
>CHL00020 psbN photosystem II protein N
Probab=20.65  E-value=44  Score=20.65  Aligned_cols=19  Identities=16%  Similarity=0.373  Sum_probs=15.2

Q ss_pred             EeeeCCCCCCCCCCCCCce
Q 030362           46 DLSFGPKYPGIHNPLDGTV   64 (179)
Q Consensus        46 ~lsFG~~~~~~~~PLdg~~   64 (179)
                      .-+||++..++.+|.|.++
T Consensus        24 YtaFGppSk~LrDPfeeHe   42 (43)
T CHL00020         24 YTAFGQPSKQLRDPFEEHE   42 (43)
T ss_pred             eeccCCchhccCCchhhcC
Confidence            4589999888899988763


Done!