BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030388
         (178 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3TVE|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Leu Complex
          Length = 66

 Score = 29.6 bits (65), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 110 MKKGLHPQMQWISYVTQSGRLMHVMMTK----IHNVGKVYHFRARRQ-MAQSIGQVAKFR 164
           MK+G+HP++     +   G ++    TK    +    K + F   +Q    + G+V +F+
Sbjct: 1   MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQ 60

Query: 165 RRY 167
           RRY
Sbjct: 61  RRY 63


>pdb|3TVH|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Leu Complex
          Length = 63

 Score = 29.3 bits (64), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 110 MKKGLHPQMQWISYVTQSGRLMHVMMTK----IHNVGKVYHFRARRQ-MAQSIGQVAKFR 164
           MK+G+HP++     +   G ++    TK    +    K + F   +Q    + G+V +F+
Sbjct: 1   MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQ 60

Query: 165 RRY 167
           RRY
Sbjct: 61  RRY 63


>pdb|2J01|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4).
           This File Contains The 50s Subunit From Molecule I.
 pdb|2J03|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 4 Of 4).
           This File Contains The 50s Subunit From Molecule Ii.
 pdb|2HGJ|3 Chain 3, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
           This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgi.
 pdb|2HGQ|3 Chain 3, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           With Translocated And Rotated Shine-Dalgarno Duplex.
           This Entry 2hgq Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgp.
 pdb|2HGU|3 Chain 3, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
           P-Site Trnas At 4.5a. This Entry 2hgu Contains 50s
           Ribosomal Subunit. The 30s Ribosomal Subunit Can Be
           Found In Pdb Entry 2hgr.
 pdb|2V47|4 Chain 4, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 2 Of 4). This File Contains The 50s
           Subunit For Molecule 1.
 pdb|2V49|4 Chain 4, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 4 Of 4). This File Contains The 50s
           Subunit Of Molecule 2.
 pdb|2WDI|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule I.
 pdb|2WDJ|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna. This File
           Contains The 50s Subunit For Molecule Ii.
 pdb|2WDL|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule I.
 pdb|2WDN|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 50s
           Subunit For Molecule Ii.
 pdb|2WH2|4 Chain 4, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 pdb|3HUX|4 Chain 4, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule I.
 pdb|3HUZ|4 Chain 4, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 50s Subunit For Molecule Ii.
 pdb|2WRJ|4 Chain 4, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 2 Of 4).
 pdb|2WRL|4 Chain 4, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State. (Part 4 Of
           4).
 pdb|2WRO|4 Chain 4, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 2 Of 4).
 pdb|2WRR|4 Chain 4, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 4 Of 4).
 pdb|3KIR|4 Chain 4, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 2 Of 4)
 pdb|3KIT|4 Chain 4, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 4 Of 4)
 pdb|3KIW|4 Chain 4, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 2 Of 4)
 pdb|3KIY|4 Chain 4, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 4 Of 4)
 pdb|3KNI|4 Chain 4, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule I
 pdb|3KNK|4 Chain 4, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 50s Subunit For Molecule Ii.
 pdb|3KNM|4 Chain 4, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule I.
 pdb|3KNO|4 Chain 4, The Structures Of Capreomycin Bound To The 70s Ribosome.
           Thi Contains The 50s Subunit For Molecule Ii
 pdb|3I8F|4 Chain 4, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8f Contains 50s Ribosomal Subunit. The 30s
           Ribosoma Can Be Found In Pdb Entry 3i8g. Molecule B In
           The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
           (50s).
 pdb|3I8I|4 Chain 4, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
           Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 pdb|3I9C|4 Chain 4, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9c Contains 50s Ribosomal Subunit Of Molecule B.
           The 30s Subunit Can Be Found In Pdb Entry 3i9b. Molecule
           A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
           And 3i9e (50s)
 pdb|3I9E|4 Chain 4, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9e Contains 50s Ribosomal Subunit Of Molecule A.
           The 30s Subunit Can Be Found In Pdb Entry 3i9d. Molecule
           B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
           And 3i9c (50s)
 pdb|2X9S|4 Chain 4, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 pdb|2X9U|4 Chain 4, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 pdb|3MRZ|1 Chain 1, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3ms0.
           Molecule A In The Same Asymmetric Unit Is Deposited As
           3mr8 (50s) And 3ms1 (30s).
 pdb|3MS1|1 Chain 1, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3ms1 Contains 50s Ribosomal Subunit. The 30s
           Ribosomal Subunit Can Be Found In Pdb Entry 3mr8.
           Molecule B In The Same Asymmetric Unit Is Deposited As
           3mrz (50s) And 3ms0 (30s).
 pdb|2XG0|4 Chain 4, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 2 Of 4)
 pdb|2XG2|4 Chain 4, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 4 Of 4)
 pdb|3OH5|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OH7|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Chloramphenicol. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OHJ|4 Chain 4, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 pdb|3OHK|4 Chain 4, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 50s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 pdb|3OHZ|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI1|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI3|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI5|4 Chain 4, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 50s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|2XQE|4 Chain 4, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The 70s
           Ribosome With A Gtp Analog
 pdb|2XTG|4 Chain 4, Trna Tranlocation On The 70s Ribosome: The        Pre-
           Translocational Translocation Intermediate Ti(Pre)
 pdb|2XUX|4 Chain 4, Trna Translocation On The 70s Ribosome: The Post-
           Translocational Translocation Intermediate Ti(Post)
 pdb|2Y0V|4 Chain 4, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0X|4 Chain 4, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0Z|4 Chain 4, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y11|4 Chain 4, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 pdb|2Y13|4 Chain 4, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y15|4 Chain 4, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 pdb|2Y17|4 Chain 4, Ef-Tu Complex 3
 pdb|2Y19|4 Chain 4, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 pdb|3ZVP|4 Chain 4, Crystal Structure Of The Hybrid State Of Ribosome In
           Complex With The Guanosine Triphosphatase Release Factor
           3
 pdb|3UXQ|4 Chain 4, The Structure Of Thermorubin In Complex With The 70s
           Ribosome From Thermus Thermophilus. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3UXR|4 Chain 4, The Structure Of Thermorubin In Complex With The 70s
           Ribosome From Thermus Thermophilus. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3UYE|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex
 pdb|3UYG|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex
 pdb|3UZ1|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex With Paromomycin
 pdb|3UZ2|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex With Paromomycin.
 pdb|3UZ8|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Tyr Complex.
 pdb|3UZ9|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Tyr Complex.
 pdb|3UZF|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex
 pdb|3UZH|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex.
 pdb|3UZK|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex With Paromomycin
 pdb|3UZN|4 Chain 4, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 50s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-cognate
           Trna-tyr Complex With Paromomycin
 pdb|4ABS|4 Chain 4, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin
           With The 70s Ribosome
 pdb|4DHA|4 Chain 4, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|4DHC|4 Chain 4, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|3V23|4 Chain 4, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V25|4 Chain 4, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 2nd Ribosome In The Asu
 pdb|3V27|4 Chain 4, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V29|4 Chain 4, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
           Entry Contains The 50s Subunit Of The 2nd Molecule In
           The Asu.
 pdb|3V2D|4 Chain 4, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 1st Ribosome In The Asu
 pdb|3V2F|4 Chain 4, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 50s Subunit Of
           The 2nd Ribosome In The Asu
 pdb|4G5L|4 Chain 4, Crystal Structure Of The 70s Ribosome With Tetracycline.
           This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5N|4 Chain 4, Crystal Structure Of The 70s Ribosome With Tetracycline.
           This Entry Contains The 50s Subunit Of Molecule B.
 pdb|4G5U|4 Chain 4, Crystal Structure Of The 70s Ribosome With Tigecycline.
           This Entry Contains The 50s Subunit Of Molecule A.
 pdb|4G5W|4 Chain 4, Crystal Structure Of The 70s Ribosome With Tigecycline.
           This Entry Contains The 50s Subunit Of Molecule B
          Length = 71

 Score = 28.9 bits (63), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 110 MKKGLHPQMQWISYVTQSGRLMHVMMTK----IHNVGKVYHFRARRQ-MAQSIGQVAKFR 164
           MK+G+HP++     +   G ++    TK    +    K + F   +Q    + G+V +F+
Sbjct: 1   MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQ 60

Query: 165 RRY 167
           RRY
Sbjct: 61  RRY 63


>pdb|2W0M|A Chain A, Crystal Structure Of Sso2452 From Sulfolobus Solfataricus
           P2
          Length = 235

 Score = 26.9 bits (58), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query: 86  HVRSSLKTFRQRLRNSVLGHY--LEKMKKGLHPQMQW-ISYVTQSGRLM 131
           HV   +  FR+ +RN  L  Y  +EKM++  H +  W I  V   G ++
Sbjct: 181 HVADGIIRFRRMIRNGELHRYILIEKMRQTDHDKHVWEIDIVNGKGIVL 229


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.133    0.399 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,240,538
Number of Sequences: 62578
Number of extensions: 196628
Number of successful extensions: 368
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 367
Number of HSP's gapped (non-prelim): 5
length of query: 178
length of database: 14,973,337
effective HSP length: 92
effective length of query: 86
effective length of database: 9,216,161
effective search space: 792589846
effective search space used: 792589846
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)