BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030389
         (178 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2LYY|A Chain A, Nmr Structure Of The Protein Nb7890a From Shewanella Sp
 pdb|2LYY|B Chain B, Nmr Structure Of The Protein Nb7890a From Shewanella Sp
          Length = 96

 Score = 28.1 bits (61), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 16/30 (53%)

Query: 42 ELPSLIHQRNPNPHINTTELSKLVRWKLTR 71
          EL  L +Q+N N  I T E+S    W L R
Sbjct: 13 ELIKLANQQNQNTEIQTGEVSASFMWALAR 42


>pdb|3FIH|M Chain M, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 30s Subunit, Trnas And The Ternary
           Complex.
 pdb|2WWL|M Chain M, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 30s, The P-Site
           Trna And The Tnac Leader Peptide (Part 1 Of 2).
 pdb|3OFP|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 pdb|3OFB|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The Second 70s Ribosome.
 pdb|3OFY|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
 pdb|3OAR|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
          Length = 113

 Score = 26.6 bits (57), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 100 SLPDLTKAVSELTVLKGVGPATASAVLAA 128
           ++PD   AV  LT + GVG   + A+LAA
Sbjct: 7   NIPDHKHAVIALTSIYGVGKTRSKAILAA 35


>pdb|1VS5|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|1VS7|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|3E1A|F Chain F, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Pre- Accommodation State
 pdb|3E1C|F Chain F, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Post-Accommodation State
 pdb|3I1M|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1O|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1Q|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1S|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1Z|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I21|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3KC4|M Chain M, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
           Ribosomal Subnit. The 50s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kcr
 pdb|3IYX|M Chain M, Coordinates Of The B1b Bridge-Forming Protein Structures
           Fitted Into The Cryo-Em Map Of E.Coli 70s Ribosome
           (Emd-1056)
 pdb|3IYY|M Chain M, Coordinates Of The B1b Bridge-Forming Protein Structures
           Fitted Into The Cryo-Em Map Of Efg.Gdpnp-Bound E.Coli
           70s Ribosome(Emd-1363)
 pdb|3OR9|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The First
           70s Ribosome.
 pdb|3ORA|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 pdb|3IZV|Q Chain Q, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
           Ef-Tu
 pdb|3IZW|Q Chain Q, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding.This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A Cognate
           Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 pdb|3SFS|M Chain M, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome
 pdb|3UOQ|M Chain M, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome (Without
           Viomycin)
 pdb|4GAQ|M Chain M, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
 pdb|4GAS|M Chain M, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
          Length = 118

 Score = 26.6 bits (57), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 100 SLPDLTKAVSELTVLKGVGPATASAVLAA 128
           ++PD   AV  LT + GVG   + A+LAA
Sbjct: 8   NIPDHKHAVIALTSIYGVGKTRSKAILAA 36


>pdb|1P6G|M Chain M, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 pdb|1P87|M Chain M, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 pdb|2AVY|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2AW7|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 pdb|2I2P|M Chain M, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2I2U|M Chain M, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QOU|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The First 70s Ribosome,
           With Spectinomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 pdb|2QOW|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The Second 70s
           Ribosome, With Spectinomycin Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|2QOY|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 pdb|2QP0|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 pdb|2QAL|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QAN|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QB9|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QBB|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBD|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           First 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBF|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBH|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The First 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2QBJ|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The Second 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2Z4K|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The First 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2Z4M|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The Second 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2VHO|M Chain M, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 3 Of 4)
 pdb|2VHP|M Chain M, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 4 Of 4)
 pdb|3DF1|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 pdb|3DF3|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 pdb|3J00|M Chain M, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
 pdb|4ADV|M Chain M, Structure Of The E. Coli Methyltransferase Ksga Bound To
           The E. Coli 30s Ribosomal Subunit
 pdb|3J0U|P Chain P, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class2 Of The Six
           Classes)
 pdb|3J0V|P Chain P, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 4a Of The Six
           Classes)
 pdb|3J0X|P Chain P, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 4b Of The Six
           Classes)
 pdb|3J0Z|P Chain P, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 5 Of The Six
           Classes)
 pdb|3J10|P Chain P, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 6 Of The Six
           Classes)
 pdb|3J13|O Chain O, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 3 Of The Six
           Classes)
          Length = 117

 Score = 26.6 bits (57), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 100 SLPDLTKAVSELTVLKGVGPATASAVLAA 128
           ++PD   AV  LT + GVG   + A+LAA
Sbjct: 7   NIPDHKHAVIALTSIYGVGKTRSKAILAA 35


>pdb|3OFO|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|3OFA|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The First 70s Ribosome.
 pdb|3OFX|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|3OAQ|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|2YKR|M Chain M, 30s Ribosomal Subunit With Rsga Bound In The Presence Of
           Gmppnp
 pdb|4A2I|M Chain M, Cryo-Electron Microscopy Structure Of The 30s Subunit In
           Complex With The Yjeq Biogenesis Factor
 pdb|3J18|M Chain M, Structure Of The Bacterial Ribosome Complexed By
           Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
           (30s Subunit)
 pdb|4GD1|M Chain M, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|4GD2|M Chain M, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
          Length = 114

 Score = 26.6 bits (57), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 100 SLPDLTKAVSELTVLKGVGPATASAVLAA 128
           ++PD   AV  LT + GVG   + A+LAA
Sbjct: 7   NIPDHKHAVIALTSIYGVGKTRSKAILAA 35


>pdb|2GY9|M Chain M, Structure Of The 30s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 pdb|2GYB|M Chain M, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 115

 Score = 26.6 bits (57), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 100 SLPDLTKAVSELTVLKGVGPATASAVLAA 128
           ++PD   AV  LT + GVG   + A+LAA
Sbjct: 7   NIPDHKHAVIALTSIYGVGKTRSKAILAA 35


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.135    0.422 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,860,808
Number of Sequences: 62578
Number of extensions: 160014
Number of successful extensions: 374
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 368
Number of HSP's gapped (non-prelim): 7
length of query: 178
length of database: 14,973,337
effective HSP length: 92
effective length of query: 86
effective length of database: 9,216,161
effective search space: 792589846
effective search space used: 792589846
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)