Citrus Sinensis ID: 030391

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MGFVGVLLTPRHPPLTCRFLWDIWNNTWYPKAADHRHSDKTWYVVDATDKILGRLASTIAIHIRGKNLATYTPSVDMGAYVIVVNAEKVAVSGKKRTQKIYRRHSGRPGGMKEETFDQLQHRIPERIIEHAVRGMLPKGRLGRELFTHLKVYKGPNHPHEAQQPIELPIRDKRIQKQR
ccCEEEEECccccccccHHHHHHHHcccccccccccccccEEEEEEcccccHHHHHHHHHHHHccccccccccccccccEEEEEEcccEEEEcccccccEEEEccccccccccccHHHHHHHccHHHHHHHHHcccccccHHHHHHHcccEEccccccccccccCEEEcccccccccc
**FVGVLLTPRHPPLTCRFLWDIWNNTWYPKAADHRHSDKTWYVVDATDKILGRLASTIAIHIRGKNLATYTPSVDMGAYVIVVNAEKVAVSGKKRTQKIYRRHSGRPGGMKEETFDQLQHRIPERIIEHAVRGMLPKGRLGRELFTHLKVYKGPNHPHEAQQPIELPI**K******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFVGVLLTPRHPPLTCRFLWDIWNNTWYPKAADHRHSDKTWYVVDATDKILGRLASTIAIHIRGKNLATYTPSVDMGAYVIVVNAEKVAVSGKKRTQKIYRRHSGRPGGMKEETFDQLQHRIPERIIEHAVRGMLPKGRLGRELFTHLKVYKGPNHPHEAQQPIELPIRDKRIQKQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L13 This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages of 50S assembly.probableQ5N0T9
50S ribosomal protein L13 This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages of 50S assembly.probableQ8YPK6
50S ribosomal protein L13, chloroplastic probableQ9SYL9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain L
Confidence level:very confident
Coverage over the Query: 40-164
View the alignment between query and template
View the model in PyMOL