Citrus Sinensis ID: 030396

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18

MKKELVRSTDLSKFSCDILISTPLRLRLAIRRKKIDLSRVEYLVLDEADKLFEVGNLLKHIDPVVKACSNPSIVRSLFSATLPDFVEELARSIMHDAVRVIVGRKNTASESIKQKLVFAGSEEGKLLALRQSFAESLNPPVLIFVQSKDRAKELYGELAFDDIRAGVIHSDLSQTQVF

cccHHHHHHHHHcccccEEEccccHHHHHHHccccccccccEEEEEcccccccccccHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHccccEEEEEcccccccccEEEEEEEccccccHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHccccEEEccccccccccc

**********LSKFSCDILISTPLRLRLAIRRKKIDLSRVEYLVLDEADKLFEVGNLLKHIDPVVKACSNPSIVRSLFSATLPDFVEELARSIMHDAVRVIVGRKNTASESIKQKLVFAGSEEGKLLALRQSFAESLNPPVLIFVQSKDRAKELYGELAFDDIRAGVIHSDLS*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKKELVRSTDLSKFSCDILISTPLRLRLAIRRKKIDLSRVEYLVLDEADKLFEVGNLLKHIDPVVKACSNPSIVRSLFSATLPDFVEELARSIMHDAVRVIVGRKNTASESIKQKLVFAGSEEGKLLALRQSFAESLNPPVLIFVQSKDRAKELYGELAFDDIRAGVIHSDLSQTQVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DEAD-box ATP-dependent RNA helicase 57		probable	Q5K5B6
DEAD-box ATP-dependent RNA helicase 57		probable	Q84TG1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I4I, chain A
Confidence level:very confident
Coverage over the Query: 6-177
View the alignment between query and template
View the model in PyMOL