BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 030403
(178 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3BBO|T Chain T, Homology Model For The Spinach Chloroplast 50s Subunit
Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
Length = 257
Score = 39.7 bits (91), Expect = 8e-04, Method: Compositional matrix adjust.
Identities = 19/37 (51%), Positives = 24/37 (64%)
Query: 138 FAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFER 174
FAVV IGS Q+ V G I+T+RLK VNDK+ +
Sbjct: 125 FAVVVIGSRQYIVIPGRWIYTQRLKGATVNDKIVLNK 161
>pdb|1NKW|P Chain P, Crystal Structure Of The Large Ribosomal Subunit From
Deinococcus Radiodurans
pdb|1NWX|P Chain P, Complex Of The Large Ribosomal Subunit From Deinococcus
Radiodurans With Abt-773
pdb|1NWY|P Chain P, Complex Of The Large Ribosomal Subunit From Deinococcus
Radiodurans With Azithromycin
pdb|1PNU|P Chain P, Crystal Structure Of A Streptomycin Dependent Ribosome
From Escherichia Coli, 50s Subunit Of 70s Ribosome. This
File, 1pnu, Contains Only Molecules Of The 50s Ribosomal
Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site
Trna Are In The Pdb File 1pns.
pdb|1PNY|P Chain P, Crystal Structure Of The Wild Type Ribosome From E. Coli,
50s Subunit Of 70s Ribosome. This File, 1pny, Contains
Only Molecules Of The 50s Ribosomal Subunit. The 30s
Subunit Is In The Pdb File 1pnx.
pdb|1SM1|P Chain P, Complex Of The Large Ribosomal Subunit From Deinococcus
Radiodurans With Quinupristin And Dalfopristin
pdb|1VOR|S Chain S, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VOU|S Chain S, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VOW|S Chain S, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VOY|S Chain S, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1VP0|S Chain S, Crystal Structure Of Five 70s Ribosomes From Escherichia
Coli In Complex With Protein Y. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Five 70s Ribosomes And Is Described
In Remark 400.
pdb|1XBP|P Chain P, Inhibition Of Peptide Bond Formation By Pleuromutilins:
The Structure Of The 50s Ribosomal Subunit From
Deinococcus Radiodurans In Complex With Tiamulin
pdb|1YL3|2 Chain 2, Crystal Structure Of 70s Ribosome With Thrs Operator And
Trnas. Large Subunit. The Coordinates For The Small
Subunit Are In The Pdb Entry 1yl4.
pdb|2B66|V Chain V, 50s Ribosomal Subunit From A Crystal Structure Of Release
Factor Rf1, Trnas And Mrna Bound To The Ribosome. This
File Contains The 50s Subunit From A Crystal Structure
Of Release Factor Rf1, Trnas And Mrna Bound To The
Ribosome And Is Described In Remark 400
pdb|2B9N|V Chain V, 50s Ribosomal Subunit From A Crystal Structure Of Release
Factor Rf2, Trnas And Mrna Bound To The Ribosome. This
File Contains The 50s Subunit From A Crystal Structure
Of Release Factor Rf1, Trnas And Mrna Bound To The
Ribosome And Is Described In Remark 400.
pdb|2B9P|V Chain V, 50s Ribosomal Subunit From A Crystal Structure Of The
Ribosome In Complex With Trnas And Mrna With A Stop
Codon In The A-Site. This File Contains The 50s Subunit
From A Crystal Structure Of The Ribosome In Complex With
Trnas And Mrna With A Stop Codon In The A-Site And Is
Described In Remark 400.
pdb|2ZJP|O Chain O, Thiopeptide Antibiotic Nosiheptide Bound To The Large
Ribosomal Subunit Of Deinococcus Radiodurans
pdb|2ZJQ|O Chain O, Interaction Of L7 With L11 Induced By Microccocin Binding
To The Deinococcus Radiodurans 50s Subunit
pdb|2ZJR|O Chain O, Refined Native Structure Of The Large Ribosomal Subunit
(50s) From Deinococcus Radiodurans
pdb|3CF5|O Chain O, Thiopeptide Antibiotic Thiostrepton Bound To The Large
Ribosomal Subunit Of Deinococcus Radiodurans
pdb|3DLL|O Chain O, The Oxazolidinone Antibiotics Perturb The Ribosomal
Peptidyl-Transferase Center And Effect Trna Positioning
pdb|3PIO|O Chain O, Crystal Structure Of The Synergistic Antibiotic Pair
Lankamycin And Lankacidin In Complex With The Large
Ribosomal Subunit
pdb|3PIP|O Chain O, Crystal Structure Of The Synergistic Antibiotic Pair
Lankamycin And Lankacidin In Complex With The Large
Ribosomal Subunit
Length = 100
Score = 33.1 bits (74), Expect = 0.078, Method: Compositional matrix adjust.
Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
Query: 138 FAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFE 173
FA++Q G Q++VS GD I E L+ E DK+ +
Sbjct: 2 FAIIQTGGKQYRVSEGDVIRVESLQ-GEAGDKVELK 36
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.134 0.411
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,363,997
Number of Sequences: 62578
Number of extensions: 130197
Number of successful extensions: 367
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 365
Number of HSP's gapped (non-prelim): 2
length of query: 178
length of database: 14,973,337
effective HSP length: 92
effective length of query: 86
effective length of database: 9,216,161
effective search space: 792589846
effective search space used: 792589846
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)