Query         030403
Match_columns 178
No_of_seqs    117 out of 760
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 13:12:21 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030403.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030403hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 CHL00075 rpl21 ribosomal prote  99.6   5E-15 1.1E-19  114.0   5.4   42  136-178     2-43  (108)
  2 PF00829 Ribosomal_L21p:  Ribos  99.5 4.6E-15 9.9E-20  111.1   4.5   41  137-178     1-41  (96)
  3 COG0261 RplU Ribosomal protein  99.5 5.3E-15 1.2E-19  114.0   5.0   41  137-178     1-41  (103)
  4 PRK05573 rplU 50S ribosomal pr  99.5 1.1E-14 2.4E-19  110.7   5.1   41  137-178     1-41  (103)
  5 KOG1686 Mitochondrial/chloropl  99.5 8.9E-15 1.9E-19  118.9   3.6   67  112-178     1-67  (151)
  6 TIGR00061 L21 ribosomal protei  99.4 1.6E-13 3.4E-18  104.4   4.8   40  138-178     1-40  (101)
  7 PF11356 Pilus_PilP:  Type IV p  91.6    0.18 3.9E-06   35.6   2.7   42  110-157    20-62  (87)
  8 PF04931 DNA_pol_phi:  DNA poly  87.3    0.47   1E-05   46.3   2.8   11  108-118   704-714 (784)
  9 PF04351 PilP:  Pilus assembly   83.4     1.4 3.1E-05   34.9   3.4   35  118-159    79-114 (149)
 10 PF10446 DUF2457:  Protein of u  81.5    0.73 1.6E-05   43.9   1.3    6  130-135   124-129 (458)
 11 COG0662 {ManC} Mannose-6-phosp  80.9     2.3 4.9E-05   32.4   3.6   22  139-160    68-89  (127)
 12 PF02311 AraC_binding:  AraC-li  79.7     2.9 6.3E-05   29.1   3.6   22  139-160    34-55  (136)
 13 PF12791 RsgI_N:  Anti-sigma fa  77.7     4.6  0.0001   26.7   3.9   33  136-175     5-37  (56)
 14 COG3168 PilP Tfp pilus assembl  72.8     5.2 0.00011   34.0   3.8   51  118-175    98-149 (170)
 15 PF07883 Cupin_2:  Cupin domain  69.6     7.5 0.00016   25.2   3.4   22  139-160    30-51  (71)
 16 KOG4264 Nucleo-cytoplasmic pro  64.7     6.3 0.00014   39.1   3.1   16   55-70     56-71  (694)
 17 PRK09943 DNA-binding transcrip  63.5      10 0.00022   30.2   3.6   22  139-160   139-160 (185)
 18 KOG0943 Predicted ubiquitin-pr  62.4     4.1 8.8E-05   44.4   1.5    7   57-63   1726-1732(3015)
 19 PF14851 FAM176:  FAM176 family  62.2      13 0.00029   30.7   4.2   14  101-114   110-123 (153)
 20 TIGR01675 plant-AP plant acid   60.7     7.5 0.00016   33.6   2.6   34  107-140   185-228 (229)
 21 PRK15047 N-hydroxyarylamine O-  60.4      14  0.0003   32.5   4.2   42  112-153    79-124 (281)
 22 PF15234 LAT:  Linker for activ  59.6      16 0.00034   32.2   4.3   12   56-67     88-99  (230)
 23 PF05764 YL1:  YL1 nuclear prot  58.8     9.4  0.0002   32.7   2.9   16   53-68     27-42  (240)
 24 PF13324 GCIP:  Grap2 and cycli  56.4     6.8 0.00015   33.5   1.6   12  104-115   179-190 (275)
 25 KOG3130 Uncharacterized conser  55.3     6.1 0.00013   38.1   1.2   13  112-124   339-351 (514)
 26 PHA03209 serine/threonine kina  54.9      29 0.00063   29.5   5.2   20  108-127    58-77  (357)
 27 PF01050 MannoseP_isomer:  Mann  53.1      20 0.00043   28.9   3.7   23  138-160    94-116 (151)
 28 PF12720 DUF3807:  Protein of u  52.9      12 0.00026   31.3   2.5   10  100-109    46-55  (172)
 29 KOG0772 Uncharacterized conser  51.8     7.3 0.00016   38.5   1.2   16  143-158   217-232 (641)
 30 PF05086 Dicty_REP:  Dictyostel  51.4     6.9 0.00015   40.1   1.0   13   60-72    884-896 (911)
 31 PHA03211 serine/threonine kina  50.4      48   0.001   30.5   6.2   13   98-110   130-142 (461)
 32 PF06249 EutQ:  Ethanolamine ut  50.1      28 0.00061   28.7   4.2   27  141-173   108-134 (152)
 33 PF03153 TFIIA:  Transcription   49.9      10 0.00022   33.6   1.7   36  115-151   329-367 (375)
 34 TIGR01713 typeII_sec_gspC gene  49.4      21 0.00046   30.9   3.5   37  116-157    81-117 (259)
 35 PF00797 Acetyltransf_2:  N-ace  48.5      27 0.00059   28.4   3.9   42  112-153    59-105 (240)
 36 PRK12784 hypothetical protein;  48.0      21 0.00045   27.4   2.9   42  135-177    31-72  (84)
 37 PF11421 Synthase_beta:  ATP sy  46.6      19 0.00042   25.1   2.3   17    1-17      1-17  (49)
 38 KOG1824 TATA-binding protein-i  45.6      19 0.00041   38.1   3.0   10    6-15    236-245 (1233)
 39 KOG0127 Nucleolar protein fibr  45.2      15 0.00033   36.6   2.2   17  146-162   285-301 (678)
 40 PF10949 DUF2777:  Protein of u  44.8      23 0.00049   30.3   3.0   22  140-161    67-88  (185)
 41 cd04867 TGS_YchF_C TGS_YchF_C:  43.2      13 0.00027   28.3   1.1   20  139-158    62-81  (83)
 42 PF05285 SDA1:  SDA1;  InterPro  43.1      14 0.00031   32.9   1.6   22    1-23     22-43  (324)
 43 TIGR03214 ura-cupin putative a  41.0      35 0.00076   29.3   3.6   23  138-160   210-232 (260)
 44 PRK15457 ethanolamine utilizat  41.0      35 0.00075   30.2   3.6   22  140-161   187-208 (233)
 45 PRK13501 transcriptional activ  38.4      36 0.00078   28.4   3.2   23  139-161    49-71  (290)
 46 PRK12766 50S ribosomal protein  36.9      28  0.0006   30.7   2.4   17   96-112    92-108 (232)
 47 PRK11171 hypothetical protein;  36.6      45 0.00097   28.7   3.5   21  139-159   216-236 (266)
 48 PF04050 Upf2:  Up-frameshift s  35.6      12 0.00027   30.2   0.0   13  135-147   120-133 (170)
 49 PRK10296 DNA-binding transcrip  35.4      51  0.0011   27.1   3.6   22  139-160    54-75  (278)
 50 PF13167 GTP-bdg_N:  GTP-bindin  35.4      41 0.00089   25.6   2.8   25  104-128     8-32  (95)
 51 PRK10371 DNA-binding transcrip  35.0      49  0.0011   28.4   3.5   22  139-160    57-78  (302)
 52 TIGR03021 pilP_fam type IV pil  34.7      44 0.00096   26.2   3.0   27  130-156    74-101 (119)
 53 COG5137 Histone chaperone invo  33.8      18 0.00039   32.6   0.7   15   98-113   202-216 (279)
 54 PTZ00305 NADH:ubiquinone oxido  33.1      38 0.00083   30.9   2.7   20  138-157    68-88  (297)
 55 PF00717 Peptidase_S24:  Peptid  31.6      38 0.00082   22.1   1.9   11  149-159    24-34  (70)
 56 TIGR02988 YaaA_near_RecF S4 do  30.8      35 0.00076   22.7   1.6   12  147-158    47-58  (59)
 57 PF11699 CENP-C_C:  Mif2/CENP-C  30.2      70  0.0015   23.7   3.3   23  140-162    45-67  (85)
 58 KOG0126 Predicted RNA-binding   29.9      55  0.0012   28.8   3.0   32  138-173    35-66  (219)
 59 cd04092 mtEFG2_II_like mtEFG2_  29.6      66  0.0014   22.3   2.9   23  149-171    60-82  (83)
 60 PTZ00007 (NAP-L) nucleosome as  29.5      48   0.001   30.4   2.7   14   54-67    267-281 (337)
 61 PF06071 YchF-GTPase_C:  Protei  29.2      12 0.00027   28.3  -0.9   19  140-158    63-81  (84)
 62 cd06530 S26_SPase_I The S26 Ty  29.2      81  0.0018   21.5   3.3   24  150-173    14-41  (85)
 63 PHA02664 hypothetical protein;  29.0      48   0.001   31.7   2.7   14  104-117   513-526 (534)
 64 TIGR01680 Veg_Stor_Prot vegeta  28.6      58  0.0012   29.3   3.0   33  108-140   212-255 (275)
 65 PF13510 Fer2_4:  2Fe-2S iron-s  28.5      30 0.00066   24.7   1.1   18  140-157     5-22  (82)
 66 PRK13500 transcriptional activ  28.2      68  0.0015   27.5   3.3   23  139-161    79-101 (312)
 67 cd01614 EutN_CcmL Ethanolamine  28.1 1.3E+02  0.0027   22.5   4.3   53  119-172     5-57  (83)
 68 TIGR02297 HpaA 4-hydroxyphenyl  26.7      77  0.0017   26.0   3.2   23  139-161    55-77  (287)
 69 cd03690 Tet_II Tet_II: This su  26.3      99  0.0021   21.9   3.4   22  149-170    62-83  (85)
 70 PF13079 DUF3916:  Protein of u  26.1      53  0.0011   27.3   2.2   21    3-23     43-63  (153)
 71 PRK13290 ectC L-ectoine syntha  26.0      85  0.0019   24.4   3.2   21  141-161    68-90  (125)
 72 cd04088 EFG_mtEFG_II EFG_mtEFG  25.9      85  0.0018   21.5   2.9   23  149-171    60-82  (83)
 73 TIGR01479 GMP_PMI mannose-1-ph  25.9      83  0.0018   29.2   3.6   22  139-160   408-429 (468)
 74 PRK10572 DNA-binding transcrip  25.8      76  0.0016   26.3   3.1   21  140-160    61-81  (290)
 75 PRK15460 cpsB mannose-1-phosph  25.7      82  0.0018   29.9   3.6   22  139-160   417-438 (478)
 76 cd04883 ACT_AcuB C-terminal AC  25.5      71  0.0015   20.8   2.3   17  107-123    55-71  (72)
 77 KOG1819 FYVE finger-containing  25.4 1.2E+02  0.0026   30.8   4.7   13  136-148   497-509 (990)
 78 cd03691 BipA_TypA_II BipA_TypA  25.3      81  0.0017   21.8   2.7   21  150-170    64-84  (86)
 79 smart00540 LEM in nuclear memb  25.3      55  0.0012   21.9   1.8   26  103-129     5-30  (44)
 80 PF12299 DUF3627:  Protein of u  25.1      30 0.00064   25.1   0.5   38  136-173    23-61  (88)
 81 PF10649 DUF2478:  Protein of u  25.0 1.7E+02  0.0036   24.2   4.9   46  108-153    18-64  (159)
 82 PRK13502 transcriptional activ  24.9      94   0.002   25.6   3.4   23  139-161    49-71  (282)
 83 PRK15448 ethanolamine cataboli  24.7 1.6E+02  0.0035   22.5   4.5   53  119-172     5-57  (95)
 84 PF04615 Utp14:  Utp14 protein;  24.6      33 0.00071   33.6   0.8   18  137-155    55-72  (735)
 85 PF04347 FliO:  Flagellar biosy  24.2      80  0.0017   22.0   2.6   26  136-161    30-57  (84)
 86 smart00835 Cupin_1 Cupin. This  24.1      86  0.0019   23.9   2.9   14  147-160    76-89  (146)
 87 PF10165 Ric8:  Guanine nucleot  24.1      97  0.0021   28.7   3.7   19   99-117   402-420 (446)
 88 KOG0795 Chorismate mutase [Ami  23.9      43 0.00094   30.1   1.4   11    4-14    149-159 (262)
 89 PRK09681 putative type II secr  23.5      82  0.0018   28.2   3.0   35  116-158    82-116 (276)
 90 PHA02885 putative interleukin   23.4      44 0.00095   27.2   1.2   29  145-173    61-94  (135)
 91 TIGR00993 3a0901s04IAP86 chlor  23.3      40 0.00088   34.4   1.2   17  104-120   424-440 (763)
 92 PRK09685 DNA-binding transcrip  23.3 1.1E+02  0.0023   25.4   3.5   22  139-160    82-103 (302)
 93 TIGR01802 CM_pl-yst monofuncti  23.1      44 0.00096   29.9   1.3   10    5-14    139-148 (246)
 94 PF05899 Cupin_3:  Protein of u  23.1 1.3E+02  0.0027   21.0   3.4   17  144-160    42-58  (74)
 95 PF14525 AraC_binding_2:  AraC-  22.8 1.2E+02  0.0027   22.2   3.4   22  139-160    66-87  (172)
 96 COG0681 LepB Signal peptidase   22.4 1.3E+02  0.0028   22.6   3.5   24  139-162    34-57  (166)
 97 PF14290 DUF4370:  Domain of un  22.1      63  0.0014   28.8   2.0   12   55-66     65-76  (239)
 98 PF11213 DUF3006:  Protein of u  21.7 1.6E+02  0.0034   20.7   3.6   32  135-172     8-42  (71)
 99 COG1917 Uncharacterized conser  21.6 1.1E+02  0.0024   22.7   3.0   21  140-160    76-96  (131)
100 PF12518 DUF3721:  Protein of u  21.5      80  0.0017   20.4   1.9   18  104-121     2-19  (34)
101 PRK13503 transcriptional activ  21.3      66  0.0014   26.1   1.9   22  139-160    46-67  (278)
102 TIGR00092 GTP-binding protein   21.3      60  0.0013   30.0   1.8   20  139-158   345-364 (368)
103 smart00596 PRE_C2HC PRE_C2HC d  21.0 1.3E+02  0.0029   22.1   3.2   34  107-140     2-35  (69)
104 PRK11171 hypothetical protein;  20.9 1.3E+02  0.0028   25.9   3.6   22  139-160    94-115 (266)
105 PF07530 PRE_C2HC:  Associated   20.8 1.5E+02  0.0032   21.1   3.3   33  107-139     2-34  (68)
106 smart00481 POLIIIAc DNA polyme  20.5 1.1E+02  0.0024   20.2   2.6   27  101-127    12-38  (67)
107 KOG1819 FYVE finger-containing  20.4 1.5E+02  0.0034   30.0   4.4    9   64-72    419-427 (990)
108 KOG0262 RNA polymerase I, larg  20.3      45 0.00097   36.4   0.8   16  145-160  1432-1447(1640)
109 PF04712 Radial_spoke:  Radial   20.2      63  0.0014   30.8   1.8    7   53-59    334-340 (491)
110 KOG1824 TATA-binding protein-i  20.2      47   0.001   35.3   1.0    8   86-93    336-344 (1233)

No 1  
>CHL00075 rpl21 ribosomal protein L21
Probab=99.55  E-value=5e-15  Score=113.98  Aligned_cols=42  Identities=19%  Similarity=0.272  Sum_probs=40.5

Q ss_pred             ceEEEEeeCCeEEEEeCCCEEEecccCCCCCCCeEEecccccC
Q 030403          136 PAFAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFERPCWF  178 (178)
Q Consensus       136 ~MYAIVeiGGKQYKV~eGD~I~VErL~~aEvGdkI~LdkVLLv  178 (178)
                      .|||||++|||||||++||+|.||+|+ +++|++|+|++|||+
T Consensus         2 ~myAIi~~gGkQykV~~Gd~i~vekl~-~~~G~~i~l~~VL~~   43 (108)
T CHL00075          2 MTYAIIEAGGKQLWVEPGRFYDINHFP-LEPGTKILLNRVLLI   43 (108)
T ss_pred             cEEEEEEECCEEEEEeCCCEEEEEEcC-CCCCCEEEEEEEEEE
Confidence            699999999999999999999999997 899999999999985


No 2  
>PF00829 Ribosomal_L21p:  Ribosomal prokaryotic L21 protein;  InterPro: IPR001787 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L21 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L21 is known to bind to the 23S rRNA in the presence of L20. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities, groups:  Bacterial L21.  Marchantia polymorpha chloroplast L21. Cyanelle L21. Plant chloroplast L21 (nuclear-encoded).   Bacterial L21 is a protein of about 100 amino-acid residues, the mature form of the spinach chloroplast L21 has 200 residues.; GO: 0003723 RNA binding, 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2XG0_V 2X9S_V 2XG2_V 3UZ1_2 2Y19_V 2WDL_V 3V23_V 2WRO_V 2WRL_V 2Y11_V ....
Probab=99.54  E-value=4.6e-15  Score=111.13  Aligned_cols=41  Identities=39%  Similarity=0.712  Sum_probs=38.7

Q ss_pred             eEEEEeeCCeEEEEeCCCEEEecccCCCCCCCeEEecccccC
Q 030403          137 AFAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFERPCWF  178 (178)
Q Consensus       137 MYAIVeiGGKQYKV~eGD~I~VErL~~aEvGdkI~LdkVLLv  178 (178)
                      |||||++|||||||++||+|.|++|. +++|++|+|++|||+
T Consensus         1 myAIi~~ggkQykV~~gd~i~v~~l~-~~~G~~i~l~~VL~~   41 (96)
T PF00829_consen    1 MYAIIEIGGKQYKVEEGDVIDVERLD-AEVGDKIELDKVLLI   41 (96)
T ss_dssp             -EEEEESSSEEEEESSSEEEEEESTS-SSTTSEEEETTEEEE
T ss_pred             CEEEEEECCEEEEEeCCCEEEECCcC-cCCCCEEEEEEEEEE
Confidence            99999999999999999999999995 999999999999985


No 3  
>COG0261 RplU Ribosomal protein L21 [Translation, ribosomal structure and biogenesis]
Probab=99.54  E-value=5.3e-15  Score=114.04  Aligned_cols=41  Identities=34%  Similarity=0.629  Sum_probs=40.0

Q ss_pred             eEEEEeeCCeEEEEeCCCEEEecccCCCCCCCeEEecccccC
Q 030403          137 AFAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFERPCWF  178 (178)
Q Consensus       137 MYAIVeiGGKQYKV~eGD~I~VErL~~aEvGdkI~LdkVLLv  178 (178)
                      |||||++|||||||++||+|+||+|. +++|++|+|++|||+
T Consensus         1 mYAii~tGGKQykV~~G~~i~vEkl~-~e~g~~v~f~~VL~v   41 (103)
T COG0261           1 MYAIIKTGGKQYKVEEGDVIKVEKLD-AEPGDKVEFDEVLMV   41 (103)
T ss_pred             CeEEEEECCEEEEEecCCEEEEEEcC-CCCCCEEEEEEEEEE
Confidence            99999999999999999999999997 899999999999986


No 4  
>PRK05573 rplU 50S ribosomal protein L21; Validated
Probab=99.52  E-value=1.1e-14  Score=110.66  Aligned_cols=41  Identities=34%  Similarity=0.648  Sum_probs=39.8

Q ss_pred             eEEEEeeCCeEEEEeCCCEEEecccCCCCCCCeEEecccccC
Q 030403          137 AFAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFERPCWF  178 (178)
Q Consensus       137 MYAIVeiGGKQYKV~eGD~I~VErL~~aEvGdkI~LdkVLLv  178 (178)
                      |||||++|||||||++||+|.|++|+ +++|++|.|++|||+
T Consensus         1 MyAIi~~gGkQykV~~Gd~i~v~~l~-~~~G~~i~l~~VL~~   41 (103)
T PRK05573          1 MYAIIKTGGKQYKVEEGDVIKVEKLD-AEVGDTVEFDEVLLV   41 (103)
T ss_pred             CEEEEEECCEEEEEeCCCEEEEcccC-CCCCCEEEEeEEEEE
Confidence            99999999999999999999999997 999999999999985


No 5  
>KOG1686 consensus Mitochondrial/chloroplast ribosomal L21 protein [Translation, ribosomal structure and biogenesis]
Probab=99.51  E-value=8.9e-15  Score=118.93  Aligned_cols=67  Identities=36%  Similarity=0.378  Sum_probs=65.0

Q ss_pred             HHHHhCcEEecccccCccccccCCceEEEEeeCCeEEEEeCCCEEEecccCCCCCCCeEEecccccC
Q 030403          112 EAAEIGYKVLGPLRKSDRVFKKYEPAFAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFERPCWF  178 (178)
Q Consensus       112 ea~~igykvvg~~~~~~~~~k~~~~MYAIVeiGGKQYKV~eGD~I~VErL~~aEvGdkI~LdkVLLv  178 (178)
                      ||+.|+|+|||++.++.+-+.+|++.||||.+||+||||+.||+||.++++.++++|+|.+++|||+
T Consensus         1 ea~~~e~v~vg~l~s~~~~~~kr~~~favv~v~srq~kvs~gd~iy~eg~~p~nv~d~i~l~kVlLv   67 (151)
T KOG1686|consen    1 MAASSETVTVGRLASACSHSIKRPSGFAVVSVGSRQRKVSSGDTIYTEGLKPKNVLDSIPLPKVLLV   67 (151)
T ss_pred             CcccceeEEEeccchhhhhccccCCccEEEEEcceeEEecCCCeeeecCccccccccccccceEEEe
Confidence            5788999999999999999999999999999999999999999999999999999999999999985


No 6  
>TIGR00061 L21 ribosomal protein L21. Eubacterial and chloroplast.
Probab=99.42  E-value=1.6e-13  Score=104.44  Aligned_cols=40  Identities=30%  Similarity=0.634  Sum_probs=38.7

Q ss_pred             EEEEeeCCeEEEEeCCCEEEecccCCCCCCCeEEecccccC
Q 030403          138 FAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFERPCWF  178 (178)
Q Consensus       138 YAIVeiGGKQYKV~eGD~I~VErL~~aEvGdkI~LdkVLLv  178 (178)
                      ||||++|||||||++||+|.||+|+ +++|+.|+|++|||+
T Consensus         1 yAIi~~gGkQykV~~Gd~i~Ve~l~-~~~G~~i~l~~VLlv   40 (101)
T TIGR00061         1 YAIVEIGGKQYKVEEGQTVRIEKLD-AAPGDTVEFDKVLMV   40 (101)
T ss_pred             CEEEEECCEEEEEeCCCEEEEcccC-CCCCCEEEEEEEEEE
Confidence            8999999999999999999999997 899999999999985


No 7  
>PF11356 Pilus_PilP:  Type IV pilus biogenesis;  InterPro: IPR022753  Type IV pili are required for auto-agglutination, twitching motility, biofilm formation, adherence and DNA uptake during transformation []. PilP is an inner membrane protein, required for pilus expression and transformation []. PilP interacts with PilQ which suggests that the two proteins may have coordinated activity in functions such as pilus extrusion/retraction []. ; PDB: 3OSS_C 2LNV_A.
Probab=91.61  E-value=0.18  Score=35.62  Aligned_cols=42  Identities=21%  Similarity=0.284  Sum_probs=28.8

Q ss_pred             HHHHHHhCcEEecccccCccccccCCceEEEEe-eCCeEEEEeCCCEEE
Q 030403          110 EAEAAEIGYKVLGPLRKSDRVFKKYEPAFAVVQ-IGSHQFKVSNGDSIF  157 (178)
Q Consensus       110 ~~ea~~igykvvg~~~~~~~~~k~~~~MYAIVe-iGGKQYKV~eGD~I~  157 (178)
                      ...+...+++++|-+...      ....+|||+ .+|+|..+..||.|-
T Consensus        20 ~~~~~~~~l~L~Gvi~~~------~~~~~Aii~~~~~~~~~~~~Gd~i~   62 (87)
T PF11356_consen   20 PAPATSLNLTLVGVISGG------GGRSSAIIRPSGGEQRTYRVGDTIP   62 (87)
T ss_dssp             -S--S-SSSEEEEEE-SC------SSS-EEEEE-CTTEEEEE-TTEE-S
T ss_pred             CCCCCCCCcEEEEEEEcC------CCceEEEEEeCCCcEEEEECcCEeC
Confidence            345566789999988322      267899999 999999999999987


No 8  
>PF04931 DNA_pol_phi:  DNA polymerase phi;  InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=87.26  E-value=0.47  Score=46.32  Aligned_cols=11  Identities=27%  Similarity=0.220  Sum_probs=5.8

Q ss_pred             HHHHHHHHhCc
Q 030403          108 EKEAEAAEIGY  118 (178)
Q Consensus       108 e~~~ea~~igy  118 (178)
                      -..+.++++|.
T Consensus       704 ~~~~l~~aL~~  714 (784)
T PF04931_consen  704 FRSALAKALGD  714 (784)
T ss_pred             HHHHHHHHhcc
Confidence            33444666664


No 9  
>PF04351 PilP:  Pilus assembly protein, PilP;  InterPro: IPR007446 The PilP family are periplasmic proteins involved in the biogenesis of type IV pili [].; PDB: 2Y4Y_B 2Y4X_A 2IVW_A 2LC4_A.
Probab=83.39  E-value=1.4  Score=34.91  Aligned_cols=35  Identities=29%  Similarity=0.443  Sum_probs=28.8

Q ss_pred             cEEecccccCccccccCCceEEEEee-CCeEEEEeCCCEEEec
Q 030403          118 YKVLGPLRKSDRVFKKYEPAFAVVQI-GSHQFKVSNGDSIFTE  159 (178)
Q Consensus       118 ykvvg~~~~~~~~~k~~~~MYAIVei-GGKQYKV~eGD~I~VE  159 (178)
                      .|.||-|...       ..++|+|+. .|+=|+|..|++|=-+
T Consensus        79 LklvG~l~~~-------~~~~ALv~~pdg~v~~V~~G~yiG~n  114 (149)
T PF04351_consen   79 LKLVGTLSQG-------GQPWALVQDPDGKVYRVKVGDYIGQN  114 (149)
T ss_dssp             EEEEEEEEET-------TEEEEEEEE-TTEEEEEETTEEETTT
T ss_pred             eEEEEEEeeC-------CEEEEEEEeCCCCEEEecCCCEeccC
Confidence            5889987533       578999999 9999999999998543


No 10 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=81.55  E-value=0.73  Score=43.91  Aligned_cols=6  Identities=0%  Similarity=-0.042  Sum_probs=2.7

Q ss_pred             ccccCC
Q 030403          130 VFKKYE  135 (178)
Q Consensus       130 ~~k~~~  135 (178)
                      .|+|..
T Consensus       124 ~WtP~~  129 (458)
T PF10446_consen  124 FWTPGA  129 (458)
T ss_pred             eecccc
Confidence            445543


No 11 
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]
Probab=80.94  E-value=2.3  Score=32.40  Aligned_cols=22  Identities=32%  Similarity=0.604  Sum_probs=20.1

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      |+|.++|+++-|++||.++|+.
T Consensus        68 g~v~~~~~~~~v~~gd~~~iP~   89 (127)
T COG0662          68 GKVTIGGEEVEVKAGDSVYIPA   89 (127)
T ss_pred             EEEEECCEEEEecCCCEEEECC
Confidence            6688999999999999999974


No 12 
>PF02311 AraC_binding:  AraC-like ligand binding domain;  InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC. The crystal structure of the arabinose-binding and dimerization domain of the Escherichia coli gene regulatory protein AraC was determined in the presence and absence of L-arabinose. The arabinose-bound molecule shows that the protein adopts an unusual fold, binding sugar within a beta barrel and completely burying the arabinose with the amino-terminal arm of the protein. Dimer contacts in the presence of arabinose are mediated by an antiparallel coiled-coil. In the uncomplexed protein, the amino-terminal arm is disordered, uncovering the sugar-binding pocket and allowing it to serve as an oligomerization interface [].; GO: 0006355 regulation of transcription, DNA-dependent; PDB: 1XJA_B 2ARA_A 2AAC_B 2ARC_A.
Probab=79.69  E-value=2.9  Score=29.09  Aligned_cols=22  Identities=14%  Similarity=0.404  Sum_probs=16.6

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      +.+.++|++|.|++|+++.+..
T Consensus        34 ~~~~~~~~~~~l~~g~~~li~p   55 (136)
T PF02311_consen   34 GTLHIDGQEYPLKPGDLFLIPP   55 (136)
T ss_dssp             EEEEETTEEEEE-TT-EEEE-T
T ss_pred             EEEEECCEEEEEECCEEEEecC
Confidence            4578999999999999999864


No 13 
>PF12791 RsgI_N:  Anti-sigma factor N-terminus;  InterPro: IPR024449 The heat shock genes in Bacillus subtilis can be classified into several groups according to their regulation [], and the sigma gene, sigI, of Bacillus subtilis belongs to the group IV heat-shock response genes and has many orthologues in the bacterial phylum Firmicutes []. Regulation of sigma factor I is carried out by RsgI from the same operon. This entry represents the N-terminal cytoplasmic portion of RsgI ('upstream' of the single transmembrane helix) which has been shown to interact directly with Sigma-I [].
Probab=77.70  E-value=4.6  Score=26.75  Aligned_cols=33  Identities=24%  Similarity=0.376  Sum_probs=26.5

Q ss_pred             ceEEEEeeCCeEEEEeCCCEEEecccCCCCCCCeEEeccc
Q 030403          136 PAFAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFERP  175 (178)
Q Consensus       136 ~MYAIVeiGGKQYKV~eGD~I~VErL~~aEvGdkI~LdkV  175 (178)
                      .-||||-+.       .|+++.|.+..++++|++|.|+..
T Consensus         5 ~~~aiVlT~-------dGeF~~ik~~~~~~vG~eI~~~~~   37 (56)
T PF12791_consen    5 KKYAIVLTP-------DGEFIKIKRKPGMEVGQEIEFDEK   37 (56)
T ss_pred             CCEEEEEcC-------CCcEEEEeCCCCCcccCEEEEech
Confidence            346777665       688899998888999999999863


No 14 
>COG3168 PilP Tfp pilus assembly protein PilP [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=72.79  E-value=5.2  Score=33.96  Aligned_cols=51  Identities=12%  Similarity=0.297  Sum_probs=35.5

Q ss_pred             cEEecccccCccccccCCceEEEEeeCCeEEEEeCCCEEEecccCCCCC-CCeEEeccc
Q 030403          118 YKVLGPLRKSDRVFKKYEPAFAVVQIGSHQFKVSNGDSIFTERLKFCEV-NDKLSFERP  175 (178)
Q Consensus       118 ykvvg~~~~~~~~~k~~~~MYAIVeiGGKQYKV~eGD~I~VErL~~aEv-GdkI~LdkV  175 (178)
                      +|.||-+.       ..+..+|+|+..|+-|+|..|++|=.+.=+=+.+ .+.|.|+++
T Consensus        98 ~rlvGtm~-------~g~~~~A~i~~~~~v~~V~vG~YlGqN~GrV~rI~d~~i~l~El  149 (170)
T COG3168          98 FRLVGTLK-------SGQGVSALIEAPGGVYRVRVGQYLGQNYGRVVRITDDSIVLNEL  149 (170)
T ss_pred             eeeEEEec-------CCCceEEEEEcCCceEEEeeccEeeccCceEEEecCCeEEeeee
Confidence            67787654       4467899999999999999999997553221122 345666554


No 15 
>PF07883 Cupin_2:  Cupin domain;  InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel). ; PDB: 2OPK_C 3BU7_B 2PHD_D 3NVC_A 3NKT_A 3NJZ_A 3NW4_A 3NST_A 3NL1_A 2H0V_A ....
Probab=69.56  E-value=7.5  Score=25.17  Aligned_cols=22  Identities=14%  Similarity=0.450  Sum_probs=18.7

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      +.+.++|+.+.+++||.++++.
T Consensus        30 ~~~~~~~~~~~l~~Gd~~~i~~   51 (71)
T PF07883_consen   30 GTLTVDGERVELKPGDAIYIPP   51 (71)
T ss_dssp             EEEEETTEEEEEETTEEEEEET
T ss_pred             EEEEEccEEeEccCCEEEEECC
Confidence            3455899999999999999875


No 16 
>KOG4264 consensus Nucleo-cytoplasmic protein MLN51 [General function prediction only]
Probab=64.69  E-value=6.3  Score=39.06  Aligned_cols=16  Identities=25%  Similarity=0.198  Sum_probs=9.6

Q ss_pred             cccccccccCCCCCCC
Q 030403           55 WSHYRHFSSNKNDDEG   70 (178)
Q Consensus        55 ~~~~r~fss~~~~d~~   70 (178)
                      -+|.|.+-|-+.-..+
T Consensus        56 alHlrrvesa~~~e~~   71 (694)
T KOG4264|consen   56 ALHLRRVESAKPAESV   71 (694)
T ss_pred             ccchhcccccCccccc
Confidence            4588887775543333


No 17 
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional
Probab=63.45  E-value=10  Score=30.19  Aligned_cols=22  Identities=18%  Similarity=0.369  Sum_probs=19.5

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      +.+.++|+.|.+.+||.++++.
T Consensus       139 ~~~~~~~~~~~l~~Gd~~~~~~  160 (185)
T PRK09943        139 IVLTINGQDYHLVAGQSYAINT  160 (185)
T ss_pred             EEEEECCEEEEecCCCEEEEcC
Confidence            4578999999999999999875


No 18 
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=62.40  E-value=4.1  Score=44.41  Aligned_cols=7  Identities=14%  Similarity=0.306  Sum_probs=3.5

Q ss_pred             ccccccc
Q 030403           57 HYRHFSS   63 (178)
Q Consensus        57 ~~r~fss   63 (178)
                      .-|-|.-
T Consensus      1726 q~~ef~G 1732 (3015)
T KOG0943|consen 1726 QEGEFAG 1732 (3015)
T ss_pred             CcccccC
Confidence            3455654


No 19 
>PF14851 FAM176:  FAM176 family
Probab=62.16  E-value=13  Score=30.65  Aligned_cols=14  Identities=21%  Similarity=0.126  Sum_probs=7.4

Q ss_pred             CCCCCHHHHHHHHH
Q 030403          101 GREYTLEEKEAEAA  114 (178)
Q Consensus       101 ~~~~~~ee~~~ea~  114 (178)
                      ..+||+.|..+.|.
T Consensus       110 ~nvf~sae~~e~A~  123 (153)
T PF14851_consen  110 VNVFTSAEELERAQ  123 (153)
T ss_pred             cCCcccHHHHHHHH
Confidence            34567765444443


No 20 
>TIGR01675 plant-AP plant acid phosphatase. This model explicitly excludes the VSPs which lack the nucleophilc aspartate. The possibility exists, however, that some members of this family may, while containing all of the conserved HAD-superfamily catalytic residues, lack activity and have a function related to the function of the VSPs rather than the acid phosphatases.
Probab=60.67  E-value=7.5  Score=33.56  Aligned_cols=34  Identities=29%  Similarity=0.515  Sum_probs=26.0

Q ss_pred             HHHHHHHHHhCcEEecccccC----------ccccccCCceEEE
Q 030403          107 EEKEAEAAEIGYKVLGPLRKS----------DRVFKKYEPAFAV  140 (178)
Q Consensus       107 ee~~~ea~~igykvvg~~~~~----------~~~~k~~~~MYAI  140 (178)
                      .+..++..+-||+|+|-++.+          .|.||-..+||=|
T Consensus       185 s~~R~~l~~~GYrIv~~iGDq~sDl~G~~~~~RtFKLPNPmYyi  228 (229)
T TIGR01675       185 SEVRKSLMEEGYRIWGNIGDQWSDLLGSPPGRRTFKLPNPMYYV  228 (229)
T ss_pred             HHHHHHHHhCCceEEEEECCChHHhcCCCccCceeeCCCCcccC
Confidence            455667777899999998776          4778888888743


No 21 
>PRK15047 N-hydroxyarylamine O-acetyltransferase; Provisional
Probab=60.37  E-value=14  Score=32.52  Aligned_cols=42  Identities=17%  Similarity=0.289  Sum_probs=31.1

Q ss_pred             HHHHhCcEEe---cccccC-ccccccCCceEEEEeeCCeEEEEeCC
Q 030403          112 EAAEIGYKVL---GPLRKS-DRVFKKYEPAFAVVQIGSHQFKVSNG  153 (178)
Q Consensus       112 ea~~igykvv---g~~~~~-~~~~k~~~~MYAIVeiGGKQYKV~eG  153 (178)
                      --.++||+|.   |++... ...+.+...|.-+|.++|++|.|-.|
T Consensus        79 ~L~~LGF~v~~~~arV~~~~~~~~~~~tH~~l~V~i~~~~yLvDVG  124 (281)
T PRK15047         79 VLRELGFNVRSLLGRVVLSNPPALPPRTHRLLLVELEGEKWIADVG  124 (281)
T ss_pred             HHHHcCCcEEEEEEEEEecCCCCCCCcCcEEEEEEECCeeEEEEec
Confidence            4568999976   444332 23346778999999999999999876


No 22 
>PF15234 LAT:  Linker for activation of T-cells
Probab=59.57  E-value=16  Score=32.18  Aligned_cols=12  Identities=25%  Similarity=0.182  Sum_probs=6.9

Q ss_pred             ccccccccCCCC
Q 030403           56 SHYRHFSSNKND   67 (178)
Q Consensus        56 ~~~r~fss~~~~   67 (178)
                      .++|.=||+..-
T Consensus        88 gShrmpSSrqds   99 (230)
T PF15234_consen   88 GSHRMPSSRQDS   99 (230)
T ss_pred             CcccCcccccCC
Confidence            367776765433


No 23 
>PF05764 YL1:  YL1 nuclear protein;  InterPro: IPR008895 The proteins in this family are designated YL1 []. They have been shown to be DNA-binding and may be transcription factors [].; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=58.80  E-value=9.4  Score=32.66  Aligned_cols=16  Identities=25%  Similarity=0.729  Sum_probs=10.4

Q ss_pred             CccccccccccCCCCC
Q 030403           53 TNWSHYRHFSSNKNDD   68 (178)
Q Consensus        53 ~~~~~~r~fss~~~~d   68 (178)
                      .||-|.-.|.-...|+
T Consensus        27 ~~~~~~~~f~Eee~D~   42 (240)
T PF05764_consen   27 FFWNQYGLFQEEEDDE   42 (240)
T ss_pred             hhhhhcccccccCCCc
Confidence            4687777777655444


No 24 
>PF13324 GCIP:  Grap2 and cyclin-D-interacting; PDB: 3AY5_A.
Probab=56.37  E-value=6.8  Score=33.55  Aligned_cols=12  Identities=33%  Similarity=0.196  Sum_probs=5.8

Q ss_pred             CCHHHHHHHHHH
Q 030403          104 YTLEEKEAEAAE  115 (178)
Q Consensus       104 ~~~ee~~~ea~~  115 (178)
                      +|+||++.....
T Consensus       179 ~seee~~~~~~~  190 (275)
T PF13324_consen  179 LSEEEMELAKAV  190 (275)
T ss_dssp             --HHHHHHHHHH
T ss_pred             CCHHHHHHHHHH
Confidence            788876544443


No 25 
>KOG3130 consensus Uncharacterized conserved protein [Function unknown]
Probab=55.27  E-value=6.1  Score=38.06  Aligned_cols=13  Identities=23%  Similarity=0.051  Sum_probs=6.5

Q ss_pred             HHHHhCcEEeccc
Q 030403          112 EAAEIGYKVLGPL  124 (178)
Q Consensus       112 ea~~igykvvg~~  124 (178)
                      +|..+-=+-.|..
T Consensus       339 ~~~r~~~~stG~~  351 (514)
T KOG3130|consen  339 EAKRKRKNSTGSG  351 (514)
T ss_pred             HHHHHHhcccccc
Confidence            4444544455555


No 26 
>PHA03209 serine/threonine kinase US3; Provisional
Probab=54.90  E-value=29  Score=29.46  Aligned_cols=20  Identities=25%  Similarity=0.469  Sum_probs=14.7

Q ss_pred             HHHHHHHHhCcEEecccccC
Q 030403          108 EKEAEAAEIGYKVLGPLRKS  127 (178)
Q Consensus       108 e~~~ea~~igykvvg~~~~~  127 (178)
                      .........||+++..|...
T Consensus        58 ~~~~~~~~~~y~~~~~lg~G   77 (357)
T PHA03209         58 KAREVVASLGYTVIKTLTPG   77 (357)
T ss_pred             hhhhhhhhcCcEEEEEecCC
Confidence            33455667899999998765


No 27 
>PF01050 MannoseP_isomer:  Mannose-6-phosphate isomerase;  InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5.3.1.8 from EC) (PMI) is the enzyme that catalyses the interconversion of mannose-6-phosphate and fructose-6-phosphate. In eukaryotes PMI is involved in the synthesis of GDP-mannose, a constituent of N- and O-linked glycans and GPI anchors and in prokaryotes it participates in a variety of pathways, including capsular polysaccharide biosynthesis and D-mannose metabolism. PMI's belong to the cupin superfamily whose functions range from isomerase and epimerase activities involved in the modification of cell wall carbohydrates in bacteria and plants, to non-enzymatic storage proteins in plant seeds, and transcription factors linked to congenital baldness in mammals []. Three classes of PMI have been defined []. The type II phosphomannose isomerases are bifunctional enzymes 5.3.1.8 from EC. This entry covers the isomerase region of the protein []. The guanosine diphospho-D-mannose pyrophosphorylase region is described in another InterPro entry (see IPR005836 from INTERPRO).; GO: 0016779 nucleotidyltransferase activity, 0005976 polysaccharide metabolic process
Probab=53.12  E-value=20  Score=28.95  Aligned_cols=23  Identities=30%  Similarity=0.615  Sum_probs=20.7

Q ss_pred             EEEEeeCCeEEEEeCCCEEEecc
Q 030403          138 FAVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       138 YAIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      -|.|.++++.+.|.+|+.++|++
T Consensus        94 ~a~v~~~~~~~~~~~g~sv~Ip~  116 (151)
T PF01050_consen   94 TAEVTLDDEEFTLKEGDSVYIPR  116 (151)
T ss_pred             eEEEEECCEEEEEcCCCEEEECC
Confidence            47789999999999999999874


No 28 
>PF12720 DUF3807:  Protein of unknown function (DUF3807);  InterPro: IPR024526 This is a family of conserved fungal proteins of unknown function.
Probab=52.90  E-value=12  Score=31.27  Aligned_cols=10  Identities=30%  Similarity=0.235  Sum_probs=7.9

Q ss_pred             CCCCCCHHHH
Q 030403          100 LGREYTLEEK  109 (178)
Q Consensus       100 ~~~~~~~ee~  109 (178)
                      .||-||.|+.
T Consensus        46 VKRTLTDEQI   55 (172)
T PF12720_consen   46 VKRTLTDEQI   55 (172)
T ss_pred             CcccccHHHH
Confidence            4889999874


No 29 
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]
Probab=51.84  E-value=7.3  Score=38.51  Aligned_cols=16  Identities=25%  Similarity=0.418  Sum_probs=9.6

Q ss_pred             eCCeEEEEeCCCEEEe
Q 030403          143 IGSHQFKVSNGDSIFT  158 (178)
Q Consensus       143 iGGKQYKV~eGD~I~V  158 (178)
                      |++-||-|.-+.++.|
T Consensus       217 i~sl~ys~Tg~~iLvv  232 (641)
T KOG0772|consen  217 INSLQYSVTGDQILVV  232 (641)
T ss_pred             cceeeecCCCCeEEEE
Confidence            5666777755555444


No 30 
>PF05086 Dicty_REP:  Dictyostelium (Slime Mold) REP protein;  InterPro: IPR007778 This family consists of REP proteins from a number of Dictyostelium species (Slime molds). REP protein is probably involved in transcription regulation and control of DNA replication, specifically the amplification of plasmid at low copy numbers. The formation of homomultimers may be required for their regulatory activity [].
Probab=51.42  E-value=6.9  Score=40.11  Aligned_cols=13  Identities=46%  Similarity=0.800  Sum_probs=6.0

Q ss_pred             ccccCCCCCCCCC
Q 030403           60 HFSSNKNDDEGED   72 (178)
Q Consensus        60 ~fss~~~~d~~~~   72 (178)
                      +|.+...+|.+|+
T Consensus       884 ~f~~~~~~d~dE~  896 (911)
T PF05086_consen  884 QFQSNGDEDTDED  896 (911)
T ss_pred             HHHhcCCcccccc
Confidence            4555544444433


No 31 
>PHA03211 serine/threonine kinase US3; Provisional
Probab=50.41  E-value=48  Score=30.45  Aligned_cols=13  Identities=38%  Similarity=0.271  Sum_probs=7.2

Q ss_pred             CCCCCCCCHHHHH
Q 030403           98 PDLGREYTLEEKE  110 (178)
Q Consensus        98 ~~~~~~~~~ee~~  110 (178)
                      ..+....|.++.+
T Consensus       130 ~~~~~~~t~~~l~  142 (461)
T PHA03211        130 PAPPGGLTPEELE  142 (461)
T ss_pred             CCCCCCCChhhhh
Confidence            3444566677644


No 32 
>PF06249 EutQ:  Ethanolamine utilisation protein EutQ;  InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine. The role of EutQ in this process is unclear [].; PDB: 2PYT_B 3LWC_A.
Probab=50.13  E-value=28  Score=28.68  Aligned_cols=27  Identities=22%  Similarity=0.543  Sum_probs=20.4

Q ss_pred             EeeCCeEEEEeCCCEEEecccCCCCCCCeEEec
Q 030403          141 VQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFE  173 (178)
Q Consensus       141 VeiGGKQYKV~eGD~I~VErL~~aEvGdkI~Ld  173 (178)
                      |.+.|+-|...+||+|++++      |.+|+|.
T Consensus       108 i~~~G~~~~A~~GDvi~iPk------Gs~I~fs  134 (152)
T PF06249_consen  108 ISIDGQTVTAKPGDVIFIPK------GSTITFS  134 (152)
T ss_dssp             EEETTEEEEEETT-EEEE-T------T-EEEEE
T ss_pred             EEECCEEEEEcCCcEEEECC------CCEEEEe
Confidence            45899999999999999876      4488874


No 33 
>PF03153 TFIIA:  Transcription factor IIA, alpha/beta subunit;  InterPro: IPR004855 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [], and can dissociate HMGB1 already bound to TBP/TATA-box. Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 []. This entry represents the precursor that yields both the alpha and beta subunits of TFIIA. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II []. ; GO: 0006367 transcription initiation from RNA polymerase II promoter, 0005672 transcription factor TFIIA complex; PDB: 1NVP_B 1YTF_B 1RM1_C 1NH2_B.
Probab=49.87  E-value=10  Score=33.58  Aligned_cols=36  Identities=17%  Similarity=0.208  Sum_probs=19.5

Q ss_pred             HhCcEEecccccCcc---ccccCCceEEEEeeCCeEEEEe
Q 030403          115 EIGYKVLGPLRKSDR---VFKKYEPAFAVVQIGSHQFKVS  151 (178)
Q Consensus       115 ~igykvvg~~~~~~~---~~k~~~~MYAIVeiGGKQYKV~  151 (178)
                      ..+.-|+.-+.+=.|   .||- .---.|+.++||=|...
T Consensus       329 ~~~~~~~c~~~kv~r~k~~wk~-~lk~g~~~~~~~d~~f~  367 (375)
T PF03153_consen  329 DTDNVVLCQYDKVTRVKNKWKC-TLKDGIMHINGKDYVFQ  367 (375)
T ss_dssp             TTS-EEEEEEEEEEEETTEEEE-EEEEEEEEETTEEEEEE
T ss_pred             CcCCEEEEEeeccccccceeEE-EeeeeEEEECCeEEEEe
Confidence            455555554433222   2222 23568889999988654


No 34 
>TIGR01713 typeII_sec_gspC general secretion pathway protein C. This model represents GspC, protein C of the main terminal branch of the general secretion pathway, also called type II secretion. This system transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens.
Probab=49.42  E-value=21  Score=30.92  Aligned_cols=37  Identities=24%  Similarity=0.337  Sum_probs=31.2

Q ss_pred             hCcEEecccccCccccccCCceEEEEeeCCeEEEEeCCCEEE
Q 030403          116 IGYKVLGPLRKSDRVFKKYEPAFAVVQIGSHQFKVSNGDSIF  157 (178)
Q Consensus       116 igykvvg~~~~~~~~~k~~~~MYAIVeiGGKQYKV~eGD~I~  157 (178)
                      +.-+++|-+..++     .+.-+|||+.+|+|.....||.|-
T Consensus        81 L~l~L~Gv~~~~~-----~~~s~AiI~~~~~q~~y~iGd~i~  117 (259)
T TIGR01713        81 LSLKLTGIVASSD-----RIRSIAIIEEGSEQVSLGINESFE  117 (259)
T ss_pred             cceEEEEEEEcCC-----CcceEEEEEeCCeEEEEeCCCCcC
Confidence            5678899998766     256789999999999999999985


No 35 
>PF00797 Acetyltransf_2:  N-acetyltransferase;  InterPro: IPR001447 Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30 kDa. It facilitates the transfer of an acetyl group from acetyl coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (Mycobacterium tuberculosis, Mycobacterium smegmatis etc) to Homo sapiens (Human). It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid. NAT catalyses the reaction:  Acetyl-coA + arylamine = coA + N-acetylarylamine   NAT is the target of a common genetic polymorphism of clinical relevance in humans. The N-acetylation polymorphism is determined by low or high NAT activity in liver. NAT has been implicated in the action and toxicity of amine-containing drugs, and in the susceptibility to cancer and systematic lupus erythematosus. Two highly similar human genes for NAT, termed NAT1 and NAT2, encode genetically invariant and variant NAT proteins, respectively. ; GO: 0016407 acetyltransferase activity, 0008152 metabolic process; PDB: 1W6F_A 1W5R_A 1GX3_D 2PQT_A 2IJA_A 1W4T_A 2BSZ_B 3D9W_B 3LTW_A 3LNB_A ....
Probab=48.50  E-value=27  Score=28.41  Aligned_cols=42  Identities=14%  Similarity=0.268  Sum_probs=28.3

Q ss_pred             HHHHhCcEEe---cccccCccc--cccCCceEEEEeeCCeEEEEeCC
Q 030403          112 EAAEIGYKVL---GPLRKSDRV--FKKYEPAFAVVQIGSHQFKVSNG  153 (178)
Q Consensus       112 ea~~igykvv---g~~~~~~~~--~k~~~~MYAIVeiGGKQYKV~eG  153 (178)
                      .-.++||+|-   |++......  ..+...|--||.+.|+.|.|-.|
T Consensus        59 lL~~lGf~v~~~~arv~~~~~~~~~~~~~H~~liV~~~~~~ylvDvG  105 (240)
T PF00797_consen   59 LLRELGFDVTLVSARVYSPGGPDYWPPRTHLVLIVTLDGERYLVDVG  105 (240)
T ss_dssp             HHHHCT-EEEEEEEEEETTTTTCCSSSEEEEEEEEEETTEEEEE-SS
T ss_pred             HHHHCCCeEEEEEEEEEeCCCCCCCCCCceEEEEEEECCEEEEEecc
Confidence            3467999986   333333222  45667899999999999999876


No 36 
>PRK12784 hypothetical protein; Provisional
Probab=48.02  E-value=21  Score=27.36  Aligned_cols=42  Identities=14%  Similarity=0.019  Sum_probs=38.0

Q ss_pred             CceEEEEeeCCeEEEEeCCCEEEecccCCCCCCCeEEeccccc
Q 030403          135 EPAFAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFERPCW  177 (178)
Q Consensus       135 ~~MYAIVeiGGKQYKV~eGD~I~VErL~~aEvGdkI~LdkVLL  177 (178)
                      ++.|.|=..+|+--||..|=.=+|..++ +++|++|.-+.+|+
T Consensus        31 EkL~~I~~~dg~le~v~vGiSG~I~~v~-Ve~Gq~i~~dtlL~   72 (84)
T PRK12784         31 EKLMMIRKNNGELEKVAVGISGNIRLVN-VVVGQQIHTDTLLV   72 (84)
T ss_pred             eeeeEEeecCCcEEEEEEeeeeeEEEEE-eecCceecCCcEEE
Confidence            6799999999999999999999999997 99999998877764


No 37 
>PF11421 Synthase_beta:  ATP synthase F1 beta subunit;  InterPro: IPR020971 F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF1 has five subunits: alpha3, beta3, gamma1, delta1, epsilon1. CF0 has three main subunits: a, b and c. This entry represents the beta subunit of the F1 component. The NMR solution structure of the protein in SDS micelles was found to contain two helices, an N-terminal amphipathic alpha-helix and a C-terminal alpha-helix separated by a large unstructured internal domain. The N-terminal alpha-helix is the Tom20 receptor binding site whereas the C-terminal alpha-helix is located upstream of the mitochondrial processing peptidase cleavage site [].; GO: 0005524 ATP binding, 0016887 ATPase activity, 0006200 ATP catabolic process, 0006754 ATP biosynthetic process, 0000275 mitochondrial proton-transporting ATP synthase complex, catalytic core F(1); PDB: 1PYV_A.
Probab=46.58  E-value=19  Score=25.12  Aligned_cols=17  Identities=41%  Similarity=0.452  Sum_probs=11.3

Q ss_pred             CchhhHHHHHHHhhhhh
Q 030403            1 MAHRRCLHVLSRHAAAL   17 (178)
Q Consensus         1 ma~rrcl~~ltr~~~~~   17 (178)
                      ||+||-|-.|-|.+.-.
T Consensus         1 MASRR~lSSlLRSssrr   17 (49)
T PF11421_consen    1 MASRRLLSSLLRSSSRR   17 (49)
T ss_dssp             ---SHHHHHHHHHHHTT
T ss_pred             CchHHHHHHHHHHHhcc
Confidence            99999998888876655


No 38 
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only]
Probab=45.61  E-value=19  Score=38.12  Aligned_cols=10  Identities=40%  Similarity=0.883  Sum_probs=5.5

Q ss_pred             HHHHHHHhhh
Q 030403            6 CLHVLSRHAA   15 (178)
Q Consensus         6 cl~~ltr~~~   15 (178)
                      ||-++.|++-
T Consensus       236 ~l~~i~r~ag  245 (1233)
T KOG1824|consen  236 CLAAICRQAG  245 (1233)
T ss_pred             HHHHHHHHhc
Confidence            5555555543


No 39 
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]
Probab=45.23  E-value=15  Score=36.61  Aligned_cols=17  Identities=18%  Similarity=0.518  Sum_probs=13.2

Q ss_pred             eEEEEeCCCEEEecccC
Q 030403          146 HQFKVSNGDSIFTERLK  162 (178)
Q Consensus       146 KQYKV~eGD~I~VErL~  162 (178)
                      .|=-+..|+++||-.|.
T Consensus       285 ~~en~~~~~tVFvRNL~  301 (678)
T KOG0127|consen  285 TRENITEGKTVFVRNLP  301 (678)
T ss_pred             ccccccccceEEEecCC
Confidence            45567788999998886


No 40 
>PF10949 DUF2777:  Protein of unknown function (DUF2777);  InterPro: IPR024488 This family of proteins with unknown function appears to be restricted to Bacillaceae.
Probab=44.82  E-value=23  Score=30.30  Aligned_cols=22  Identities=36%  Similarity=0.534  Sum_probs=20.1

Q ss_pred             EEeeCCeEEEEeCCCEEEeccc
Q 030403          140 VVQIGSHQFKVSNGDSIFTERL  161 (178)
Q Consensus       140 IVeiGGKQYKV~eGD~I~VErL  161 (178)
                      +|.++|.||.++.|+.|.++|-
T Consensus        67 ~v~~~~e~~~L~~ge~IRi~K~   88 (185)
T PF10949_consen   67 IVSIDGEQIPLSNGESIRIRKK   88 (185)
T ss_pred             eEEeCCeEEecCCCCEEEEeec
Confidence            6799999999999999999874


No 41 
>cd04867 TGS_YchF_C TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown. The N-terminal domain of the YchF protein belongs to the Obg-like family of GTPases, and some members of the family contain a C-terminal TGS domain. TGS is a small domain of about 50 amino acid residues with a predominantly beta-sheet structure. There is no direct information on the function of the TGS domain, but its presence in two types of regulatory proteins (the GTPases and guanosine polyphosphate phosphohydrolases/synthetases) suggests a ligand (most likely nucleotide)-binding, regulatory role.
Probab=43.18  E-value=13  Score=28.27  Aligned_cols=20  Identities=25%  Similarity=0.433  Sum_probs=17.5

Q ss_pred             EEEeeCCeEEEEeCCCEEEe
Q 030403          139 AVVQIGSHQFKVSNGDSIFT  158 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~V  158 (178)
                      ..|+.-||+|-|+.||+|.+
T Consensus        62 Gkir~eGK~Yiv~DGDi~~f   81 (83)
T cd04867          62 GKYRQEGKDYVVQDGDIIFF   81 (83)
T ss_pred             ChhhhhCCceEeeCCeEEEE
Confidence            36788899999999999975


No 42 
>PF05285 SDA1:  SDA1;  InterPro: IPR007949 This domain consists of several SDA1 protein homologues. SDA1 is a Saccharomyces cerevisiae protein which is involved in the control of the actin cytoskeleton. The protein is essential for cell viability and is localised in the nucleus [].
Probab=43.11  E-value=14  Score=32.93  Aligned_cols=22  Identities=36%  Similarity=0.252  Sum_probs=14.7

Q ss_pred             CchhhHHHHHHHhhhhhhccCCC
Q 030403            1 MAHRRCLHVLSRHAAALLSLKTP   23 (178)
Q Consensus         1 ma~rrcl~~ltr~~~~~ls~~~~   23 (178)
                      ||.| -|-.|-|.+.|-|-.+..
T Consensus        22 ~Aar-sli~l~Rev~P~lL~kkd   43 (324)
T PF05285_consen   22 MAAR-SLINLFREVNPELLHKKD   43 (324)
T ss_pred             HHHH-HHHHHHHHHCHHhcCchh
Confidence            4544 456678888888766654


No 43 
>TIGR03214 ura-cupin putative allantoin catabolism protein. This model represents a protein containing a tandem arrangement of cupin domains (N-terminal part of pfam07883 and C-terminal more distantly related to pfam00190). This protein is found in the vicinity of genes involved in the catabolism of allantoin, a breakdown product of urate and sometimes of urate iteslf. The distribution of pathway components in the genomes in which this family is observed suggests that the function is linked to the allantoate catabolism to glyoxylate pathway (GenProp0686) since it is sometimes found in genomes lacking any elements of the xanthine-to-allantoin pathways (e.g. in Enterococcus faecalis).
Probab=41.02  E-value=35  Score=29.33  Aligned_cols=23  Identities=22%  Similarity=0.296  Sum_probs=20.1

Q ss_pred             EEEEeeCCeEEEEeCCCEEEecc
Q 030403          138 FAVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       138 YAIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      -+++.++|+-+.|++||+|++.-
T Consensus       210 ~G~~~~~g~~~~V~~GD~i~i~~  232 (260)
T TIGR03214       210 KGVYNLDNNWVPVEAGDYIWMGA  232 (260)
T ss_pred             eEEEEECCEEEEecCCCEEEECC
Confidence            46778999999999999999864


No 44 
>PRK15457 ethanolamine utilization protein EutQ; Provisional
Probab=40.96  E-value=35  Score=30.20  Aligned_cols=22  Identities=18%  Similarity=0.261  Sum_probs=19.4

Q ss_pred             EEeeCCeEEEEeCCCEEEeccc
Q 030403          140 VVQIGSHQFKVSNGDSIFTERL  161 (178)
Q Consensus       140 IVeiGGKQYKV~eGD~I~VErL  161 (178)
                      .+.++|+.|.+.+||+|+|++=
T Consensus       187 ~l~IdG~t~~l~pGDvlfIPkG  208 (233)
T PRK15457        187 HVRHEGETMIAKAGDVMFIPKG  208 (233)
T ss_pred             EEEECCEEEEeCCCcEEEECCC
Confidence            3678999999999999999864


No 45 
>PRK13501 transcriptional activator RhaR; Provisional
Probab=38.42  E-value=36  Score=28.35  Aligned_cols=23  Identities=13%  Similarity=0.502  Sum_probs=19.8

Q ss_pred             EEEeeCCeEEEEeCCCEEEeccc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTERL  161 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VErL  161 (178)
                      +.+.++|+.|.+++|+.++|+.-
T Consensus        49 ~~~~i~~~~~~l~~g~~~~I~p~   71 (290)
T PRK13501         49 GLHVLNDHPYRITCGDVFYIQAA   71 (290)
T ss_pred             eEEEECCeeeeecCCeEEEEcCC
Confidence            45778999999999999999653


No 46 
>PRK12766 50S ribosomal protein L32e; Provisional
Probab=36.88  E-value=28  Score=30.74  Aligned_cols=17  Identities=18%  Similarity=0.075  Sum_probs=12.7

Q ss_pred             CCCCCCCCCCHHHHHHH
Q 030403           96 TVPDLGREYTLEEKEAE  112 (178)
Q Consensus        96 ~~~~~~~~~~~ee~~~e  112 (178)
                      -++..+.+|+.|.+...
T Consensus        92 ~~~~~~~~l~~~~~rll  108 (232)
T PRK12766         92 GLTEKTPELSDEEARLL  108 (232)
T ss_pred             ccccCCCCCCHHHHHHH
Confidence            45777888988887664


No 47 
>PRK11171 hypothetical protein; Provisional
Probab=36.63  E-value=45  Score=28.71  Aligned_cols=21  Identities=24%  Similarity=0.423  Sum_probs=18.1

Q ss_pred             EEEeeCCeEEEEeCCCEEEec
Q 030403          139 AVVQIGSHQFKVSNGDSIFTE  159 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VE  159 (178)
                      ++|.++|+-|.|++||+|++.
T Consensus       216 ~~~~~~~~~~~l~~GD~i~~~  236 (266)
T PRK11171        216 GVYRLNNDWVEVEAGDFIWMR  236 (266)
T ss_pred             EEEEECCEEEEeCCCCEEEEC
Confidence            456899999999999999975


No 48 
>PF04050 Upf2:  Up-frameshift suppressor 2 ;  InterPro: IPR007193  This entry represents Up-frameshift suppressor 2 (also known as Nonsense-mediated mRNA decay protein 2). Transcripts harbouring premature signals for translation termination are recognised and rapidly degraded by eukaryotic cells through a pathway known as nonsense-mediated mRNA decay. In Saccharomyces cerevisiae, three trans-acting factors (Upf1 to Upf3) are required for nonsense-mediated mRNA decay [].; PDB: 2WJV_D.
Probab=35.58  E-value=12  Score=30.24  Aligned_cols=13  Identities=31%  Similarity=0.595  Sum_probs=8.7

Q ss_pred             CceEEEE-eeCCeE
Q 030403          135 EPAFAVV-QIGSHQ  147 (178)
Q Consensus       135 ~~MYAIV-eiGGKQ  147 (178)
                      ...|+++ +-|+||
T Consensus       120 ~v~F~lLtKkGnK~  133 (170)
T PF04050_consen  120 KVAFTLLTKKGNKQ  133 (170)
T ss_dssp             EEEEEEEEEETTEE
T ss_pred             eEEEEEEEEcCCCC
Confidence            3468866 777765


No 49 
>PRK10296 DNA-binding transcriptional regulator ChbR; Provisional
Probab=35.36  E-value=51  Score=27.12  Aligned_cols=22  Identities=18%  Similarity=0.296  Sum_probs=19.2

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      +.+.++|+.|.+.+|+++.|+.
T Consensus        54 ~~~~i~~~~~~l~~g~l~~i~p   75 (278)
T PRK10296         54 YYQEINGKRVLLERGDFVFIPL   75 (278)
T ss_pred             EEEEECCEEEEECCCcEEEeCC
Confidence            4578899999999999999875


No 50 
>PF13167 GTP-bdg_N:  GTP-binding GTPase N-terminal
Probab=35.36  E-value=41  Score=25.56  Aligned_cols=25  Identities=36%  Similarity=0.518  Sum_probs=20.5

Q ss_pred             CCHHHHHHHHHHhCcEEecccccCc
Q 030403          104 YTLEEKEAEAAEIGYKVLGPLRKSD  128 (178)
Q Consensus       104 ~~~ee~~~ea~~igykvvg~~~~~~  128 (178)
                      .+-+|-++.|.+.||.|+|.+...-
T Consensus         8 ~~l~El~~L~~t~g~~vv~~~~q~~   32 (95)
T PF13167_consen    8 ESLEELEELAETAGYEVVGTVVQKR   32 (95)
T ss_pred             HHHHHHHHHHHHCCCeEEEEEEecC
Confidence            4567888889999999999887654


No 51 
>PRK10371 DNA-binding transcriptional regulator MelR; Provisional
Probab=35.03  E-value=49  Score=28.41  Aligned_cols=22  Identities=9%  Similarity=0.131  Sum_probs=19.7

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      +.+.++|++|.+.+||.+.|+-
T Consensus        57 ~~~~i~g~~~~l~~Gd~ili~s   78 (302)
T PRK10371         57 VEYLINNEKVQINQGHITLFWA   78 (302)
T ss_pred             EEEEECCEEEEEcCCcEEEEec
Confidence            4688999999999999999874


No 52 
>TIGR03021 pilP_fam type IV pilus biogenesis protein PilP. Members of this protein family are found in type IV pilus biogenesis loci and include proteins designated PilP.
Probab=34.66  E-value=44  Score=26.18  Aligned_cols=27  Identities=26%  Similarity=0.479  Sum_probs=23.6

Q ss_pred             ccccCCceEEEEee-CCeEEEEeCCCEE
Q 030403          130 VFKKYEPAFAVVQI-GSHQFKVSNGDSI  156 (178)
Q Consensus       130 ~~k~~~~MYAIVei-GGKQYKV~eGD~I  156 (178)
                      +|-....|.|.++. +|++..|..||.|
T Consensus        74 I~G~~~~l~A~l~l~~G~~~~v~~G~~l  101 (119)
T TIGR03021        74 IFGRGGRLTATLRLPGGREVDVQVGDSL  101 (119)
T ss_pred             EEccCCCeEEEEEeCCCcEEEecCCCcc
Confidence            55566789999999 9999999999987


No 53 
>COG5137 Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics]
Probab=33.79  E-value=18  Score=32.56  Aligned_cols=15  Identities=47%  Similarity=0.443  Sum_probs=7.6

Q ss_pred             CCCCCCCCHHHHHHHH
Q 030403           98 PDLGREYTLEEKEAEA  113 (178)
Q Consensus        98 ~~~~~~~~~ee~~~ea  113 (178)
                      ....|++..++ ++||
T Consensus       202 gEg~~e~~eee-eEE~  216 (279)
T COG5137         202 GEGNRELNEEE-EEEA  216 (279)
T ss_pred             cccchhhhhhh-hhhh
Confidence            34456666555 3344


No 54 
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional
Probab=33.11  E-value=38  Score=30.86  Aligned_cols=20  Identities=5%  Similarity=0.308  Sum_probs=17.3

Q ss_pred             EEEEeeCCeEEEE-eCCCEEE
Q 030403          138 FAVVQIGSHQFKV-SNGDSIF  157 (178)
Q Consensus       138 YAIVeiGGKQYKV-~eGD~I~  157 (178)
                      -++|.|.||++.| .+|.+|.
T Consensus        68 ~~~I~IDGk~VeV~~~G~TIL   88 (297)
T PTZ00305         68 RAIMFVNKRPVEIIPQEENLL   88 (297)
T ss_pred             ceEEEECCEEEEecCCCChHH
Confidence            4899999999999 8998763


No 55 
>PF00717 Peptidase_S24:  Peptidase S24-like peptidase classification. ;  InterPro: IPR019759 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ].; PDB: 1KCA_H 3BDN_A 1F39_A 1JHH_A 1JHE_B 3JSP_A 1JHF_B 1JHC_A 3JSO_B 1B12_D ....
Probab=31.64  E-value=38  Score=22.13  Aligned_cols=11  Identities=18%  Similarity=0.474  Sum_probs=4.6

Q ss_pred             EEeCCCEEEec
Q 030403          149 KVSNGDSIFTE  159 (178)
Q Consensus       149 KV~eGD~I~VE  159 (178)
                      .+..||++.+.
T Consensus        24 ~~~~gdivv~~   34 (70)
T PF00717_consen   24 EPKDGDIVVVK   34 (70)
T ss_dssp             ---TTSEEEEE
T ss_pred             CCccCeEEEEE
Confidence            56666666553


No 56 
>TIGR02988 YaaA_near_RecF S4 domain protein YaaA. This small protein has a single S4 domain (pfam01479), as do bacterial ribosomal protein S4, some pseudouridine synthases, tyrosyl-tRNA synthetases. The S4 domain may bind RNA. Members of this protein family are found almost exclusively in the Firmicutes, and almost invariably just a few nucleotides upstream of the gene for the DNA replication and repair protein RecF. The few members of this family that are not near recF are found instead near dnaA and/or dnaN, the usual neighbors of recF, near the origin of replication. The conserved location suggests a possible role in replication in the Firmicutes lineage.
Probab=30.80  E-value=35  Score=22.65  Aligned_cols=12  Identities=33%  Similarity=0.216  Sum_probs=7.0

Q ss_pred             EEEEeCCCEEEe
Q 030403          147 QFKVSNGDSIFT  158 (178)
Q Consensus       147 QYKV~eGD~I~V  158 (178)
                      .|+|..||.|.|
T Consensus        47 ~~~l~~Gd~v~i   58 (59)
T TIGR02988        47 GKKLYPGDVIEI   58 (59)
T ss_pred             CCCCCCCCEEEe
Confidence            456666666654


No 57 
>PF11699 CENP-C_C:  Mif2/CENP-C like; PDB: 2VPV_B.
Probab=30.24  E-value=70  Score=23.73  Aligned_cols=23  Identities=30%  Similarity=0.336  Sum_probs=17.5

Q ss_pred             EEeeCCeEEEEeCCCEEEecccC
Q 030403          140 VVQIGSHQFKVSNGDSIFTERLK  162 (178)
Q Consensus       140 IVeiGGKQYKV~eGD~I~VErL~  162 (178)
                      -|.+++++|.|..|+..+|++=+
T Consensus        45 ~Vti~~~~f~v~~G~~F~VP~gN   67 (85)
T PF11699_consen   45 EVTIHETSFVVTKGGSFQVPRGN   67 (85)
T ss_dssp             EEEETTEEEEEETT-EEEE-TT-
T ss_pred             EEEEcCcEEEEeCCCEEEECCCC
Confidence            36789999999999999998743


No 58 
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]
Probab=29.94  E-value=55  Score=28.82  Aligned_cols=32  Identities=19%  Similarity=0.456  Sum_probs=26.0

Q ss_pred             EEEEeeCCeEEEEeCCCEEEecccCCCCCCCeEEec
Q 030403          138 FAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSFE  173 (178)
Q Consensus       138 YAIVeiGGKQYKV~eGD~I~VErL~~aEvGdkI~Ld  173 (178)
                      -|-|.|||--|-+++||+|-|    +-+-|+.|.++
T Consensus        35 sA~Iyiggl~~~LtEgDil~V----FSqyGe~vdin   66 (219)
T KOG0126|consen   35 SAYIYIGGLPYELTEGDILCV----FSQYGEIVDIN   66 (219)
T ss_pred             ceEEEECCCcccccCCcEEEE----eeccCceEEEE
Confidence            488999999999999999987    33566666654


No 59 
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes.  Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species.  Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria.  Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs.  No clear phenotype has been found for mutants in the yeast homologue of mtEFG2, MEF2.  There are two forms of mtEFG present in mammals (designated mtEFG1s and mtEFG2s) mtEFG1s are n
Probab=29.64  E-value=66  Score=22.28  Aligned_cols=23  Identities=26%  Similarity=0.254  Sum_probs=19.0

Q ss_pred             EEeCCCEEEecccCCCCCCCeEE
Q 030403          149 KVSNGDSIFTERLKFCEVNDKLS  171 (178)
Q Consensus       149 KV~eGD~I~VErL~~aEvGdkI~  171 (178)
                      .+..||++.+-.++++.+||+|.
T Consensus        60 ~~~aGdI~~i~gl~~~~~Gdtl~   82 (83)
T cd04092          60 SLSAGNIGVITGLKQTRTGDTLV   82 (83)
T ss_pred             eeCCCCEEEEECCCCcccCCEEe
Confidence            46789999998887788998874


No 60 
>PTZ00007 (NAP-L) nucleosome assembly protein -L; Provisional
Probab=29.54  E-value=48  Score=30.44  Aligned_cols=14  Identities=14%  Similarity=-0.090  Sum_probs=7.2

Q ss_pred             cccccc-ccccCCCC
Q 030403           54 NWSHYR-HFSSNKND   67 (178)
Q Consensus        54 ~~~~~r-~fss~~~~   67 (178)
                      .||+.= ||--.--+
T Consensus       267 IIP~AV~yftGea~d  281 (337)
T PTZ00007        267 LIPYAVYWFLGEAID  281 (337)
T ss_pred             cccccHHhhCCCccc
Confidence            588544 55543333


No 61 
>PF06071 YchF-GTPase_C:  Protein of unknown function (DUF933);  InterPro: IPR013029 This domain is found at the C terminus of family of conserved hypothetical proteins found in both prokaryotes and eukaryotes. While the function of these proteins is not known, the crystal structure of P44681 from SWISSPROT from Haemophilus influenzae has been determined []. This protein consists of three domains: an N-terminal domain which has a mononucleotide binding fold typical for the P-loop NTPases, a central domain which forms an alpha-helical coiled coil, and this C-terminal domain which is composed of a six-stranded half-barrel curved around an alpha helix. The central domain and this domain are topologically similar to RNA-binding proteins, while the N-terminal region contains the features typical of GTP-dependent molecular switches. The purified protein was capable of binding both double-stranded nucleic acid and GTP. It was suggested, therefore, that this protein might be part of a nucleoprotein complex and could function as a GTP-dependent translation factor.; PDB: 1NI3_A 1JAL_A 2DWQ_B 2DBY_A 2OHF_A.
Probab=29.24  E-value=12  Score=28.25  Aligned_cols=19  Identities=21%  Similarity=0.448  Sum_probs=13.2

Q ss_pred             EEeeCCeEEEEeCCCEEEe
Q 030403          140 VVQIGSHQFKVSNGDSIFT  158 (178)
Q Consensus       140 IVeiGGKQYKV~eGD~I~V  158 (178)
                      .++.-||+|-|+.||+|.+
T Consensus        63 k~r~eGK~YivqDGDIi~f   81 (84)
T PF06071_consen   63 KLRLEGKDYIVQDGDIIHF   81 (84)
T ss_dssp             -SEEEETT-B--TTEEEEE
T ss_pred             CccccCCceeEeCCCEEEE
Confidence            4677899999999999985


No 62 
>cd06530 S26_SPase_I The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are translocated across biological membranes. The bacterial signal peptidase I, which is the most intensively studied, has two N-terminal transmembrane segments inserted in the plasma membrane and a hydrophilic, C-terminal catalytic region that is located in the periplasmic space. Although the bacterial signal peptidase I is monomeric, signal peptidases of eukaryotic cells commonly function as oligomeric complexes containing two divergent copies of the catalytic monomer. These are the IMP1 and IMP2 signal peptidases of the mitochondrial inner membrane that remove leader peptides from nuclear- and mitochondrial-encoded proteins. Also, two components of the endoplasmic reticulum signal peptidase in mammals (18-kDa and 21-kDa
Probab=29.20  E-value=81  Score=21.55  Aligned_cols=24  Identities=21%  Similarity=0.510  Sum_probs=11.6

Q ss_pred             EeCCCEEEecccCC----CCCCCeEEec
Q 030403          150 VSNGDSIFTERLKF----CEVNDKLSFE  173 (178)
Q Consensus       150 V~eGD~I~VErL~~----aEvGdkI~Ld  173 (178)
                      ...||+|.|++...    .+.|+.|.|.
T Consensus        14 i~~gd~v~v~~~~~~~~~~~~GDiv~~~   41 (85)
T cd06530          14 LQPGDLVLVNKLSYGFREPKRGDVVVFK   41 (85)
T ss_pred             ccCCCEEEEEEeecccCCCCCCCEEEEe
Confidence            34555555555432    3445555443


No 63 
>PHA02664 hypothetical protein; Provisional
Probab=29.02  E-value=48  Score=31.73  Aligned_cols=14  Identities=43%  Similarity=0.461  Sum_probs=8.3

Q ss_pred             CCHHHHHHHHHHhC
Q 030403          104 YTLEEKEAEAAEIG  117 (178)
Q Consensus       104 ~~~ee~~~ea~~ig  117 (178)
                      .-+||.++|++.+|
T Consensus       513 ~ieee~~ee~~vl~  526 (534)
T PHA02664        513 AIEEEEEEERAVLG  526 (534)
T ss_pred             hhhHHHHHHHHHHH
Confidence            34566666776654


No 64 
>TIGR01680 Veg_Stor_Prot vegetative storage protein. The proteins represented by this model are close relatives of the plant acid phosphatases (TIGR01675), are limited to members of the Phaseoleae including Glycine max (soybean) and Phaseolus vulgaris (kidney bean). These proteins are highly expressed in the leaves of repeatedly depodded plants. VSP differs most strinkingly from the acid phosphatases in the lack of the conserved nucleophilic aspartate residue in the N-terminus, thus, they should be inactive as phosphatases. This issue was confused by the publication in 1992 of an article claiming activity for the Glycine max VSP. In 1994 this assertion was refuted by the separation of the activity from the VSP.
Probab=28.57  E-value=58  Score=29.30  Aligned_cols=33  Identities=24%  Similarity=0.401  Sum_probs=23.7

Q ss_pred             HHHHHHHHhCcEEecccccC-----------ccccccCCceEEE
Q 030403          108 EKEAEAAEIGYKVLGPLRKS-----------DRVFKKYEPAFAV  140 (178)
Q Consensus       108 e~~~ea~~igykvvg~~~~~-----------~~~~k~~~~MYAI  140 (178)
                      +.+++..+-||+|+|-++.+           +|.||-..|||..
T Consensus       212 ~~R~~li~eGYrIv~~iGDq~sDl~G~~~g~~RtFKLPNP~~~~  255 (275)
T TIGR01680       212 AARAKLIQEGYNIVGIIGDQWNDLKGEHRGAIRSFKLPNPCTTF  255 (275)
T ss_pred             HHHHHHHHcCceEEEEECCCHHhccCCCccCcceecCCCccccc
Confidence            33566667899999988655           4777777777653


No 65 
>PF13510 Fer2_4:  2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A.
Probab=28.46  E-value=30  Score=24.75  Aligned_cols=18  Identities=22%  Similarity=0.538  Sum_probs=14.7

Q ss_pred             EEeeCCeEEEEeCCCEEE
Q 030403          140 VVQIGSHQFKVSNGDSIF  157 (178)
Q Consensus       140 IVeiGGKQYKV~eGD~I~  157 (178)
                      -|.+.||.|.|.+|+.|.
T Consensus         5 ~i~idG~~v~~~~G~til   22 (82)
T PF13510_consen    5 TITIDGKPVEVPPGETIL   22 (82)
T ss_dssp             EEEETTEEEEEEET-BHH
T ss_pred             EEEECCEEEEEcCCCHHH
Confidence            378999999999999864


No 66 
>PRK13500 transcriptional activator RhaR; Provisional
Probab=28.24  E-value=68  Score=27.46  Aligned_cols=23  Identities=9%  Similarity=0.380  Sum_probs=19.8

Q ss_pred             EEEeeCCeEEEEeCCCEEEeccc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTERL  161 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VErL  161 (178)
                      +.+.++|+.|.+.+||+++|+.-
T Consensus        79 g~~~v~~~~~~l~~Gdl~~I~~~  101 (312)
T PRK13500         79 GLHVLNDRPYRITRGDLFYIHAD  101 (312)
T ss_pred             EEEEECCEEEeecCCeEEEECCC
Confidence            45778899999999999999863


No 67 
>cd01614 EutN_CcmL Ethanolamine utilisation protein and carboxysome structural protein domain family. Beside the Escherichia coli ethanolamine utilization protein EutN and the Synechocystis sp. carboxysome (beta-type) structural protein CcmL, this family also includes alpha-type carboxysome structural proteins CsoS4A and CsoS4B (previously known as OrfA and OrfB), propanediol utilizationprotein PduN, and some hypothetical homologous of various bacterial microcompartments. The carboxysome, a polyhedral organelle, participates in carbon fixation by sequestering enzymes. It is the prototypical bacterial microcompartment. Its enzymatic components, ribulose bisphosphate carboxylase/oxygenase(RuBisCO) and carbonic anhydrase (CA), are surrounded by a polyhedral protein shell. Similarly, the ethanolamine utilization (eut) microcompartment, and the 1,2-propanediol utilization (pdu) microcompartment encapsulate the enzymes necessary for the process of cobalamin-dependent ethanolamine degradation,
Probab=28.09  E-value=1.3e+02  Score=22.50  Aligned_cols=53  Identities=13%  Similarity=0.066  Sum_probs=37.4

Q ss_pred             EEecccccCccccccCCceEEEEeeCCeEEEEeCCCEEEecccCCCCCCCeEEe
Q 030403          119 KVLGPLRKSDRVFKKYEPAFAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSF  172 (178)
Q Consensus       119 kvvg~~~~~~~~~k~~~~MYAIVeiGGKQYKV~eGD~I~VErL~~aEvGdkI~L  172 (178)
                      ||+|.+....+.-.....-+-||+.-+...+-...-.+-++.+. +-+|+.|.+
T Consensus         5 kViG~vvaT~K~~~L~G~kLliVq~~~~~~~~~g~~~VA~D~vG-AG~Ge~Vlv   57 (83)
T cd01614           5 RVIGTVVATRKHPSLAGKKLLVVQPLDGEGKPKGEPLVAVDPVG-AGVGEWVLV   57 (83)
T ss_pred             EEEeEEEEeeEcCCCCCcEEEEEEECccCCCcCCCEEEEEECCC-CCCCCEEEE
Confidence            78999888766666666667777765544444444556699995 999998865


No 68 
>TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA. This putative transcriptional regulator, which contains both the substrate-binding, dimerization domain (pfam02311) and the helix-turn-helix DNA-binding domain (pfam00165) of the AraC famil, is located proximal to genes of the 4-hydroxyphenylacetate catabolism pathway.
Probab=26.70  E-value=77  Score=25.97  Aligned_cols=23  Identities=13%  Similarity=0.148  Sum_probs=19.7

Q ss_pred             EEEeeCCeEEEEeCCCEEEeccc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTERL  161 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VErL  161 (178)
                      +.+.++|++|.+.+|+.+.++.-
T Consensus        55 ~~~~~~~~~~~l~~g~~~ii~~~   77 (287)
T TIGR02297        55 IALQLDEHEYSEYAPCFFLTPPS   77 (287)
T ss_pred             eEEEECCEEEEecCCeEEEeCCC
Confidence            46788999999999999998753


No 69 
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O). This domain has homology to domain II of the elongation factors EF-G and EF-2. Tet(M) and Tet(O) catalyze the release of tetracycline (Tc) from the ribosome in a GTP-dependent manner thereby mediating Tc resistance.  Tcs are broad-spectrum antibiotics.  Typical Tcs bind to the ribosome and inhibit the elongation phase of protein synthesis, by inhibiting the occupation of site A by aminoacyl-tRNA.
Probab=26.27  E-value=99  Score=21.87  Aligned_cols=22  Identities=36%  Similarity=0.360  Sum_probs=17.5

Q ss_pred             EEeCCCEEEecccCCCCCCCeE
Q 030403          149 KVSNGDSIFTERLKFCEVNDKL  170 (178)
Q Consensus       149 KV~eGD~I~VErL~~aEvGdkI  170 (178)
                      .|..||++-+-.++++.+|+.|
T Consensus        62 ~~~aGdI~ai~gl~~~~~Gdtl   83 (85)
T cd03690          62 TVTAGDIAILTGLKGLRVGDVL   83 (85)
T ss_pred             EECCCCEEEEECCCCCcCcccc
Confidence            4778888888888777788875


No 70 
>PF13079 DUF3916:  Protein of unknown function (DUF3916)
Probab=26.11  E-value=53  Score=27.32  Aligned_cols=21  Identities=29%  Similarity=0.482  Sum_probs=19.2

Q ss_pred             hhhHHHHHHHhhhhhhccCCC
Q 030403            3 HRRCLHVLSRHAAALLSLKTP   23 (178)
Q Consensus         3 ~rrcl~~ltr~~~~~ls~~~~   23 (178)
                      +|.|+|+|-++|.-++..+|.
T Consensus        43 kr~c~Q~LIn~a~~Li~~kp~   63 (153)
T PF13079_consen   43 KRLCIQTLINAAEHLIQAKPD   63 (153)
T ss_pred             HHHHHHHHHHHHHHHHhCCcC
Confidence            688999999999999999985


No 71 
>PRK13290 ectC L-ectoine synthase; Reviewed
Probab=26.04  E-value=85  Score=24.38  Aligned_cols=21  Identities=10%  Similarity=0.189  Sum_probs=17.2

Q ss_pred             Ee-e-CCeEEEEeCCCEEEeccc
Q 030403          141 VQ-I-GSHQFKVSNGDSIFTERL  161 (178)
Q Consensus       141 Ve-i-GGKQYKV~eGD~I~VErL  161 (178)
                      +. + +|+.|.+.+||.++++.-
T Consensus        68 ~~~i~~g~~~~L~aGD~i~~~~~   90 (125)
T PRK13290         68 VEDLATGEVHPIRPGTMYALDKH   90 (125)
T ss_pred             EEEcCCCEEEEeCCCeEEEECCC
Confidence            34 6 599999999999998743


No 72 
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes. During the process of peptide synthesis and tRNA site changes, the ribosome is moved along the mRNA a distance equal to one codon with the addition of each amino acid. In bacteria this translocation step is catalyzed by EF-G_GTP, which is hydrolyzed to provide the required energy. Thus, this action releases the uncharged tRNA from the P site and transfers the newly formed peptidyl-tRNA from the A site to the P site. Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more compl
Probab=25.93  E-value=85  Score=21.50  Aligned_cols=23  Identities=26%  Similarity=0.213  Sum_probs=18.7

Q ss_pred             EEeCCCEEEecccCCCCCCCeEE
Q 030403          149 KVSNGDSIFTERLKFCEVNDKLS  171 (178)
Q Consensus       149 KV~eGD~I~VErL~~aEvGdkI~  171 (178)
                      .+..||++.+..++.+.+|+.|.
T Consensus        60 ~~~aGdI~~i~g~~~~~~Gdtl~   82 (83)
T cd04088          60 EAGAGDIGAVAGLKDTATGDTLC   82 (83)
T ss_pred             EeCCCCEEEEECCCCCccCCEee
Confidence            46789999998888788898873


No 73 
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase. This enzyme is known to be bifunctional, as both mannose-6-phosphate isomerase (EC 5.3.1.8) (PMI) and mannose-1-phosphate guanylyltransferase (EC 2.7.7.22) in Pseudomonas aeruginosa, Xanthomonas campestris, and Gluconacetobacter xylinus. The literature on the enzyme from E. coli attributes mannose-6-phosphate isomerase activity to an adjacent gene, but the present sequence has not been shown to lack the activity. The PMI domain is C-terminal.
Probab=25.89  E-value=83  Score=29.16  Aligned_cols=22  Identities=23%  Similarity=0.394  Sum_probs=19.8

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      +.|.++|+.|.+.+||.++++.
T Consensus       408 ~~v~~dg~~~~l~~GDsi~ip~  429 (468)
T TIGR01479       408 ARVTIGDETLLLTENESTYIPL  429 (468)
T ss_pred             EEEEECCEEEEecCCCEEEECC
Confidence            5588999999999999999885


No 74 
>PRK10572 DNA-binding transcriptional regulator AraC; Provisional
Probab=25.83  E-value=76  Score=26.29  Aligned_cols=21  Identities=24%  Similarity=0.368  Sum_probs=18.7

Q ss_pred             EEeeCCeEEEEeCCCEEEecc
Q 030403          140 VVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       140 IVeiGGKQYKV~eGD~I~VEr  160 (178)
                      .+.++|+.|.+.+|+.|.+..
T Consensus        61 ~~~~~~~~~~~~~g~~i~i~p   81 (290)
T PRK10572         61 VIFNGGRAFVCRPGDLLLFPP   81 (290)
T ss_pred             EEecCCeeEecCCCCEEEECC
Confidence            467899999999999999875


No 75 
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional
Probab=25.75  E-value=82  Score=29.87  Aligned_cols=22  Identities=23%  Similarity=0.243  Sum_probs=19.4

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      +.|.++|+.|.+.+||.|+++.
T Consensus       417 ~~v~idg~~~~L~~GDSi~ip~  438 (478)
T PRK15460        417 AKVTIDGDIKLLGENESIYIPL  438 (478)
T ss_pred             EEEEECCEEEEecCCCEEEECC
Confidence            4568999999999999999874


No 76 
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB. This CD includes the C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB. AcuB is putatively involved in the anaerobic catabolism of acetoin, and related proteins. Studies report the induction of AcuB by nitrate respiration and also by fermentation. Since acetoin can be secreted and later serve as a source of carbon, it has been proposed that, during anaerobic growth when other carbon sources are exhausted, the induction of the AcuB protein  results in acetoin catabolism. AcuB-like proteins have two N-terminal tandem CBS domains and a single C-terminal ACT domain. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=25.52  E-value=71  Score=20.79  Aligned_cols=17  Identities=29%  Similarity=0.436  Sum_probs=13.3

Q ss_pred             HHHHHHHHHhCcEEecc
Q 030403          107 EEKEAEAAEIGYKVLGP  123 (178)
Q Consensus       107 ee~~~ea~~igykvvg~  123 (178)
                      ++-.+.-.+.||+|++|
T Consensus        55 ~~~~~~L~~~G~~v~~~   71 (72)
T cd04883          55 RPIIEDLRRAGYEVLWP   71 (72)
T ss_pred             HHHHHHHHHCCCeeeCC
Confidence            35566777889999997


No 77 
>KOG1819 consensus FYVE finger-containing proteins [General function prediction only]
Probab=25.38  E-value=1.2e+02  Score=30.82  Aligned_cols=13  Identities=8%  Similarity=-0.207  Sum_probs=7.6

Q ss_pred             ceEEEEeeCCeEE
Q 030403          136 PAFAVVQIGSHQF  148 (178)
Q Consensus       136 ~MYAIVeiGGKQY  148 (178)
                      +||.--+-.|.|-
T Consensus       497 de~~saeqeg~qg  509 (990)
T KOG1819|consen  497 DEEESAEQEGDQG  509 (990)
T ss_pred             chhhhhhhhhccc
Confidence            4666666666553


No 78 
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein with global regulatory properties in Escherichia coli.  BipA is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways. BipA functions as a translation factor that is required specifically for the expression of the transcriptional modulator Fis.  BipA binds to ribosomes at a site that coincides with that of EF-G and has a GTPase activity that is sensitive to high GDP:GTP ratios and, is stimulated  by 70S ribosomes programmed with mRNA and aminoacylated tRNAs. The growth rate-dependent induction of BipA allows the efficient expression of Fis, thereby modulating a range of downstream processes, including DNA metabolism and type III secretion.
Probab=25.31  E-value=81  Score=21.83  Aligned_cols=21  Identities=14%  Similarity=0.289  Sum_probs=18.2

Q ss_pred             EeCCCEEEecccCCCCCCCeE
Q 030403          150 VSNGDSIFTERLKFCEVNDKL  170 (178)
Q Consensus       150 V~eGD~I~VErL~~aEvGdkI  170 (178)
                      +..||++.+..++++.+|+.+
T Consensus        64 ~~aG~I~~i~gl~~~~~Gdtl   84 (86)
T cd03691          64 AEAGDIVAIAGIEDITIGDTI   84 (86)
T ss_pred             ECCCCEEEEECCCCCccccee
Confidence            688999999998878899886


No 79 
>smart00540 LEM in nuclear membrane-associated proteins. LEM, domain in nuclear membrane-associated proteins, including lamino-associated polypeptide 2 and emerin.
Probab=25.28  E-value=55  Score=21.93  Aligned_cols=26  Identities=27%  Similarity=0.423  Sum_probs=22.9

Q ss_pred             CCCHHHHHHHHHHhCcEEecccccCcc
Q 030403          103 EYTLEEKEAEAAEIGYKVLGPLRKSDR  129 (178)
Q Consensus       103 ~~~~ee~~~ea~~igykvvg~~~~~~~  129 (178)
                      .+|.+|-.++..+.|+.+ ||+..+-|
T Consensus         5 ~LSd~eL~~~L~~~G~~~-gPIt~sTR   30 (44)
T smart00540        5 RLSDAELRAELKQYGLPP-GPITDTTR   30 (44)
T ss_pred             HcCHHHHHHHHHHcCCCC-CCcCcchH
Confidence            389999999999999998 99998754


No 80 
>PF12299 DUF3627:  Protein of unknown function (DUF3627);  InterPro: IPR022549  This domain is found in bacteria and viruses, and is approximately 90 amino acids in length. The domain is found C-terminal to PF02498 from PFAM. 
Probab=25.14  E-value=30  Score=25.12  Aligned_cols=38  Identities=18%  Similarity=0.381  Sum_probs=29.2

Q ss_pred             ceEEEEeeCCeEEEEeCCCEEEecccCC-CCCCCeEEec
Q 030403          136 PAFAVVQIGSHQFKVSNGDSIFTERLKF-CEVNDKLSFE  173 (178)
Q Consensus       136 ~MYAIVeiGGKQYKV~eGD~I~VErL~~-aEvGdkI~Ld  173 (178)
                      +++||++-+|.||.+--|+--++.+... .....+|.|+
T Consensus        23 ~~l~v~~~~~~~y~~irgQ~~~~~~~k~k~~~~~~ii~d   61 (88)
T PF12299_consen   23 PRLAVLKNDGNQYAFIRGQKRYVRRRKKKLKKDMEIIYD   61 (88)
T ss_pred             eEEEEEEeCCcEEEEEehhHHHHHHHHHHhcCCceEEEE
Confidence            5999999999999999999999886541 1225566665


No 81 
>PF10649 DUF2478:  Protein of unknown function (DUF2478);  InterPro: IPR018912  This is a family of hypothetical bacterial proteins encoded in the vicinity of molybdenum ABC transporter gene-products MobA, MobB and MobC. However the function could not be confirmed. 
Probab=25.02  E-value=1.7e+02  Score=24.19  Aligned_cols=46  Identities=11%  Similarity=-0.012  Sum_probs=34.6

Q ss_pred             HHHHHHHHhCcEEecccccC-ccccccCCceEEEEeeCCeEEEEeCC
Q 030403          108 EKEAEAAEIGYKVLGPLRKS-DRVFKKYEPAFAVVQIGSHQFKVSNG  153 (178)
Q Consensus       108 e~~~ea~~igykvvg~~~~~-~~~~k~~~~MYAIVeiGGKQYKV~eG  153 (178)
                      +-.+...+-|++|.|-++.+ ...-...-.|....-..|.+|.+++.
T Consensus        18 ~~a~~L~~~G~rv~G~vQ~~~~~~~~~~~~m~l~dl~~G~~~~IsQ~   64 (159)
T PF10649_consen   18 AFAARLRARGVRVAGLVQRNTADGDGGRCDMDLRDLPSGRRIRISQD   64 (159)
T ss_pred             HHHHHHHhCCCeEEEEeccccCCCCCCccceEEEECCCCCEEEEeec
Confidence            34455667799999999987 33344445799988899999988764


No 82 
>PRK13502 transcriptional activator RhaR; Provisional
Probab=24.86  E-value=94  Score=25.56  Aligned_cols=23  Identities=9%  Similarity=0.393  Sum_probs=19.8

Q ss_pred             EEEeeCCeEEEEeCCCEEEeccc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTERL  161 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VErL  161 (178)
                      ..+.++|+.|.+.+|+++.|+.-
T Consensus        49 ~~~~i~~~~~~l~~g~l~li~~~   71 (282)
T PRK13502         49 GLHVLNERPYRITRGDLFYIRAE   71 (282)
T ss_pred             EEEEECCEEEeecCCcEEEECCC
Confidence            55778899999999999999853


No 83 
>PRK15448 ethanolamine catabolic microcompartment shell protein EutN; Provisional
Probab=24.70  E-value=1.6e+02  Score=22.52  Aligned_cols=53  Identities=9%  Similarity=0.034  Sum_probs=36.7

Q ss_pred             EEecccccCccccccCCceEEEEeeCCeEEEEeCCCEEEecccCCCCCCCeEEe
Q 030403          119 KVLGPLRKSDRVFKKYEPAFAVVQIGSHQFKVSNGDSIFTERLKFCEVNDKLSF  172 (178)
Q Consensus       119 kvvg~~~~~~~~~k~~~~MYAIVeiGGKQYKV~eGD~I~VErL~~aEvGdkI~L  172 (178)
                      ||+|.+...-+.-.....-+-||+.-....+-.-.-.|-++.+. +-+|+.|.+
T Consensus         5 kViG~vvaT~K~~~L~G~kLliVq~~~~~~~~~g~~~VAvD~vG-AG~Ge~Vlv   57 (95)
T PRK15448          5 VVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIG-AGTGEWVLL   57 (95)
T ss_pred             EEEeEEEEeeecCCCCCcEEEEEEECccCCCcCCCEEEEEECCC-CCCCCEEEE
Confidence            78898887766666666677788864444443333445599995 999999865


No 84 
>PF04615 Utp14:  Utp14 protein;  InterPro: IPR006709 A large ribonuclear protein complex is required for the processing of the small-ribosomal-subunit rRNA - the small-subunit (SSU) processome [, ]. This preribosomal complex contains the U3 snoRNA and at least 40 proteins, which have the following properties:   They are nucleolar. They are able to coimmunoprecipitate with the U3 snoRNA and Mpp10 (a protein specific to the SSU processome).  They are required for 18S rRNA biogenesis.  There appears to be a linkage between polymerase I transcription and the formation of the SSU processome; as some, but not all, of the SSU processome components are required for pre-rRNA transcription initiation. These SSU processome components have been termed t-Utps. They form a pre-complex with pre-18S rRNA in the absence of snoRNA U3 and other SSU processome components. It has been proposed that the t-Utp complex proteins are both rDNA and rRNA binding proteins that are involved in the initiation of pre18S rRNA transcription. Initially binding to rDNA then associating with the 5' end of the nascent pre18S rRNA. The t-Utpcomplex forms the nucleus around which the rest of the SSU processome components, including snoRNA U3, assemble []. From electron microscopy the SSU processome may correspond to the terminal knobs visualized at the 5' ends of nascent 18S rRNA.   This entry contains Utp14, a large ribonuclear protein associated with snoRNA U3 [].; GO: 0006364 rRNA processing, 0032040 small-subunit processome
Probab=24.60  E-value=33  Score=33.59  Aligned_cols=18  Identities=28%  Similarity=0.410  Sum_probs=7.4

Q ss_pred             eEEEEeeCCeEEEEeCCCE
Q 030403          137 AFAVVQIGSHQFKVSNGDS  155 (178)
Q Consensus       137 MYAIVeiGGKQYKV~eGD~  155 (178)
                      -|++...++.. +|..+|.
T Consensus        55 ef~~~~~~~~~-kl~l~dL   72 (735)
T PF04615_consen   55 EFNLSSSGADD-KLSLSDL   72 (735)
T ss_pred             cccCCccCccC-cccHHHH
Confidence            45554433222 4444443


No 85 
>PF04347 FliO:  Flagellar biosynthesis protein, FliO;  InterPro: IPR022781  FliO is an essential component of the flagellum-specific protein export apparatus []. It is an integral membrane protein. Its precise molecular function is unknown. FliO is a short protein found in flagellar biosynthesis operons, and which contains a highly hydrophobic N-terminal sequence followed generally by two basic amino acids. This region is reminiscent of but distinct from the twin-arginine translocation signal sequence. Some instances of this gene have been names "FliZ" but phylogenetic tree building supports a single FliO family.; GO: 0043064 flagellum organization, 0016021 integral to membrane, 0019861 flagellum
Probab=24.23  E-value=80  Score=22.02  Aligned_cols=26  Identities=15%  Similarity=0.318  Sum_probs=18.7

Q ss_pred             ceEEEEeeCCeEEEEeCCC--EEEeccc
Q 030403          136 PAFAVVQIGSHQFKVSNGD--SIFTERL  161 (178)
Q Consensus       136 ~MYAIVeiGGKQYKV~eGD--~I~VErL  161 (178)
                      ..=.||++||++|.|-.++  +-.+..+
T Consensus        30 ~~l~lV~v~~~~~Llgvt~~~i~~L~~l   57 (84)
T PF04347_consen   30 KSLVLVEVGGRYLLLGVTDGGITLLAEL   57 (84)
T ss_pred             CEEEEEEECCEEEEEEECCCCCEEEEEe
Confidence            3567999999999986664  4444455


No 86 
>smart00835 Cupin_1 Cupin. This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel). This family contains 11S and 7S plant seed storage proteins, and germins. Plant seed storage proteins provide the major nitrogen source for the developing plant.
Probab=24.13  E-value=86  Score=23.92  Aligned_cols=14  Identities=14%  Similarity=0.387  Sum_probs=12.6

Q ss_pred             EEEEeCCCEEEecc
Q 030403          147 QFKVSNGDSIFTER  160 (178)
Q Consensus       147 QYKV~eGD~I~VEr  160 (178)
                      .+.+++||.++|+.
T Consensus        76 ~~~l~~GD~~~ip~   89 (146)
T smart00835       76 DARLREGDVFVVPQ   89 (146)
T ss_pred             EEEecCCCEEEECC
Confidence            89999999999875


No 87 
>PF10165 Ric8:  Guanine nucleotide exchange factor synembryn;  InterPro: IPR019318  Ric8 is involved in the EGL-30 neurotransmitter signalling pathway []. It is a guanine nucleotide exchange factor [] that regulates neurotransmitter secretion. 
Probab=24.11  E-value=97  Score=28.73  Aligned_cols=19  Identities=42%  Similarity=0.282  Sum_probs=15.0

Q ss_pred             CCCCCCCHHHHHHHHHHhC
Q 030403           99 DLGREYTLEEKEAEAAEIG  117 (178)
Q Consensus        99 ~~~~~~~~ee~~~ea~~ig  117 (178)
                      .+--++|+||||.||+.+-
T Consensus       402 ~~~~~mt~eeke~ea~~l~  420 (446)
T PF10165_consen  402 NPMPEMTEEEKEREAERLF  420 (446)
T ss_pred             CCccccchhHHHHHHHHHH
Confidence            3445699999999999753


No 88 
>KOG0795 consensus Chorismate mutase [Amino acid transport and metabolism]
Probab=23.92  E-value=43  Score=30.06  Aligned_cols=11  Identities=45%  Similarity=0.739  Sum_probs=9.7

Q ss_pred             hhHHHHHHHhh
Q 030403            4 RRCLHVLSRHA   14 (178)
Q Consensus         4 rrcl~~ltr~~   14 (178)
                      -+|||.||||+
T Consensus       149 ~~CLQ~LSrRI  159 (262)
T KOG0795|consen  149 IECLQSLSRRI  159 (262)
T ss_pred             HHHHHHHHHHh
Confidence            48999999986


No 89 
>PRK09681 putative type II secretion protein GspC; Provisional
Probab=23.52  E-value=82  Score=28.24  Aligned_cols=35  Identities=17%  Similarity=0.140  Sum_probs=28.4

Q ss_pred             hCcEEecccccCccccccCCceEEEEeeCCeEEEEeCCCEEEe
Q 030403          116 IGYKVLGPLRKSDRVFKKYEPAFAVVQIGSHQFKVSNGDSIFT  158 (178)
Q Consensus       116 igykvvg~~~~~~~~~k~~~~MYAIVeiGGKQYKV~eGD~I~V  158 (178)
                      ++-+..|.+..++.        -|||+.+|+|--...||.|--
T Consensus        82 LnL~L~GVvass~~--------~AII~~~G~Q~tY~iGd~i~g  116 (276)
T PRK09681         82 LNVVLRGIAFGARP--------GAVIEEGGKQQVYLQGETLGS  116 (276)
T ss_pred             cceEEEEEEecCCc--------eEEEecCCcEeEEeCCcccCC
Confidence            45677888876653        399999999999999999943


No 90 
>PHA02885 putative interleukin binding protein; Provisional
Probab=23.41  E-value=44  Score=27.20  Aligned_cols=29  Identities=24%  Similarity=0.355  Sum_probs=23.0

Q ss_pred             CeEEEE-----eCCCEEEecccCCCCCCCeEEec
Q 030403          145 SHQFKV-----SNGDSIFTERLKFCEVNDKLSFE  173 (178)
Q Consensus       145 GKQYKV-----~eGD~I~VErL~~aEvGdkI~Ld  173 (178)
                      |.-||+     ++|.+|+++.+.++..|+..+|.
T Consensus        61 gyiywi~pnntspgeyif~enl~g~~egqd~t~a   94 (135)
T PHA02885         61 GYIYWIGPNNTSPGEYIFIENLEGANEGQDNTFA   94 (135)
T ss_pred             ceEEEEeCCCCCCcceeeeecccccccCccchhh
Confidence            445554     67899999999999999987763


No 91 
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains. The long precursor of the 86K protein originally described is proposed to have three domains. The N-terminal A-domain is acidic, repetitive, weakly conserved, readily removed by proteolysis during chloroplast isolation, and not required for protein translocation. The other domains are designated G (GTPase) and M (membrane anchor); this family includes most of the G domain and all of M.
Probab=23.34  E-value=40  Score=34.38  Aligned_cols=17  Identities=29%  Similarity=0.472  Sum_probs=11.9

Q ss_pred             CCHHHHHHHHHHhCcEE
Q 030403          104 YTLEEKEAEAAEIGYKV  120 (178)
Q Consensus       104 ~~~ee~~~ea~~igykv  120 (178)
                      ||.|++.+-.++.-|++
T Consensus       424 l~k~q~k~y~de~dyr~  440 (763)
T TIGR00993       424 LSKEQRKAYLEEYDYRV  440 (763)
T ss_pred             HhHHHHHHHHHHHHHHH
Confidence            56777777777777765


No 92 
>PRK09685 DNA-binding transcriptional activator FeaR; Provisional
Probab=23.30  E-value=1.1e+02  Score=25.44  Aligned_cols=22  Identities=18%  Similarity=0.439  Sum_probs=18.7

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      +.+..+|++|.|.+|+++.++.
T Consensus        82 ~~~~~~g~~~~l~~G~~~l~~~  103 (302)
T PRK09685         82 AIIEQDDRQVQLAAGDITLIDA  103 (302)
T ss_pred             EEEEECCeEEEEcCCCEEEEEC
Confidence            4467899999999999999865


No 93 
>TIGR01802 CM_pl-yst monofunctional chorismate mutase, eukaryotic type. This model represents the plant and yeast (plastidic) chorismate mutase. These CM's are distinct from other forms by the presence of an extended regulatory domain.
Probab=23.12  E-value=44  Score=29.89  Aligned_cols=10  Identities=50%  Similarity=0.893  Sum_probs=8.5

Q ss_pred             hHHHHHHHhh
Q 030403            5 RCLHVLSRHA   14 (178)
Q Consensus         5 rcl~~ltr~~   14 (178)
                      -|||+||||+
T Consensus       139 ~cLQALSrRI  148 (246)
T TIGR01802       139 ECLQSLSRRI  148 (246)
T ss_pred             HHHHHHHHHh
Confidence            5999999986


No 94 
>PF05899 Cupin_3:  Protein of unknown function (DUF861);  InterPro: IPR008579 The function of the proteins in this entry are unknown. They contain the conserved barrel domain of the 'cupin' superfamily and members are specific to plants and bacteria.; PDB: 1RC6_A 3MYX_A 1O5U_A 2K9Z_A 1LKN_A 3ES4_A 1SFN_B 3BCW_A.
Probab=23.08  E-value=1.3e+02  Score=21.02  Aligned_cols=17  Identities=18%  Similarity=0.438  Sum_probs=14.6

Q ss_pred             CCeEEEEeCCCEEEecc
Q 030403          144 GSHQFKVSNGDSIFTER  160 (178)
Q Consensus       144 GGKQYKV~eGD~I~VEr  160 (178)
                      +|.++.+.+||.+++++
T Consensus        42 ~G~~~~~~aGD~~~~p~   58 (74)
T PF05899_consen   42 DGETVTFKAGDAFFLPK   58 (74)
T ss_dssp             TTEEEEEETTEEEEE-T
T ss_pred             CCCEEEEcCCcEEEECC
Confidence            89999999999999764


No 95 
>PF14525 AraC_binding_2:  AraC-binding-like domain
Probab=22.77  E-value=1.2e+02  Score=22.16  Aligned_cols=22  Identities=18%  Similarity=0.483  Sum_probs=18.3

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      +.++.||.++.+.+|+.+.++-
T Consensus        66 ~~~~~~g~~~~~~pg~~~l~d~   87 (172)
T PF14525_consen   66 ARIEQGGREVELAPGDVVLLDP   87 (172)
T ss_pred             EEEEECCEEEEEcCCeEEEEcC
Confidence            4578899999999999888764


No 96 
>COG0681 LepB Signal peptidase I [Intracellular trafficking and secretion]
Probab=22.36  E-value=1.3e+02  Score=22.63  Aligned_cols=24  Identities=25%  Similarity=0.461  Sum_probs=16.9

Q ss_pred             EEEeeCCeEEEEeCCCEEEecccC
Q 030403          139 AVVQIGSHQFKVSNGDSIFTERLK  162 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VErL~  162 (178)
                      .+|.-++=+=-...||.|.|+++.
T Consensus        34 ~~V~s~SM~Ptl~~GD~v~v~k~~   57 (166)
T COG0681          34 VVVPSGSMEPTLNVGDRVLVKKFS   57 (166)
T ss_pred             EEECCCccccccccCCEEEEEecc
Confidence            345555556666689999999865


No 97 
>PF14290 DUF4370:  Domain of unknown function (DUF4370)
Probab=22.14  E-value=63  Score=28.78  Aligned_cols=12  Identities=33%  Similarity=0.778  Sum_probs=9.7

Q ss_pred             cccccccccCCC
Q 030403           55 WSHYRHFSSNKN   66 (178)
Q Consensus        55 ~~~~r~fss~~~   66 (178)
                      |-.+|+||++-+
T Consensus        65 ~~~~R~fS~d~~   76 (239)
T PF14290_consen   65 WGSRRFFSEDVS   76 (239)
T ss_pred             cchhhhcccccc
Confidence            779999999643


No 98 
>PF11213 DUF3006:  Protein of unknown function (DUF3006);  InterPro: IPR021377  This family of proteins has no known function. 
Probab=21.66  E-value=1.6e+02  Score=20.73  Aligned_cols=32  Identities=25%  Similarity=0.313  Sum_probs=18.6

Q ss_pred             CceEEEEeeCCeEEEEeCCCEEEec--ccC-CCCCCCeEEe
Q 030403          135 EPAFAVVQIGSHQFKVSNGDSIFTE--RLK-FCEVNDKLSF  172 (178)
Q Consensus       135 ~~MYAIVeiGGKQYKV~eGD~I~VE--rL~-~aEvGdkI~L  172 (178)
                      +.=|||+.+.+.+      ..+.|+  +|. ++..||.|.+
T Consensus         8 E~~~AVl~~~~~~------~~~~vp~~~LP~~~keGDvl~i   42 (71)
T PF11213_consen    8 EGDYAVLELEDGE------KEIDVPRSRLPEGAKEGDVLEI   42 (71)
T ss_pred             eCCEEEEEECCCe------EEEEEEHHHCCCCCCcccEEEE
Confidence            3568999998877      122332  232 3556666555


No 99 
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown]
Probab=21.59  E-value=1.1e+02  Score=22.65  Aligned_cols=21  Identities=24%  Similarity=0.370  Sum_probs=17.7

Q ss_pred             EEeeCCeEEEEeCCCEEEecc
Q 030403          140 VVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       140 IVeiGGKQYKV~eGD~I~VEr  160 (178)
                      .++++|.=+.+.+||+|+++.
T Consensus        76 ~~~~~g~~~~l~~Gd~i~ip~   96 (131)
T COG1917          76 TVQLEGEKKELKAGDVIIIPP   96 (131)
T ss_pred             EEEecCCceEecCCCEEEECC
Confidence            356778899999999999886


No 100
>PF12518 DUF3721:  Protein of unknown function;  InterPro: IPR022196  This domain family is found in bacteria and eukaryotes, and is approximately 30 amino acids in length. There is a conserved WMPC sequence motif. There are two completely conserved residues (A and C) that may be functionally important. 
Probab=21.52  E-value=80  Score=20.44  Aligned_cols=18  Identities=39%  Similarity=0.322  Sum_probs=14.4

Q ss_pred             CCHHHHHHHHHHhCcEEe
Q 030403          104 YTLEEKEAEAAEIGYKVL  121 (178)
Q Consensus       104 ~~~ee~~~ea~~igykvv  121 (178)
                      .|.+|-++.|.++|++=+
T Consensus         2 ~tk~eAe~~A~~~GC~G~   19 (34)
T PF12518_consen    2 PTKAEAEKRAKELGCKGA   19 (34)
T ss_pred             CcHHHHHHHHHHcCCcch
Confidence            377888999999998743


No 101
>PRK13503 transcriptional activator RhaS; Provisional
Probab=21.34  E-value=66  Score=26.15  Aligned_cols=22  Identities=14%  Similarity=0.366  Sum_probs=19.2

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      +.+.++|++|.+.+|+.+.|..
T Consensus        46 ~~~~i~~~~~~l~~g~~~~i~~   67 (278)
T PRK13503         46 GIHVFNGQPYTLSGGTVCFVRD   67 (278)
T ss_pred             eeeEecCCcccccCCcEEEECC
Confidence            4578899999999999999964


No 102
>TIGR00092 GTP-binding protein YchF. This predicted GTP-binding protein is found in a single copy in every complete bacterial genome, and is found in Eukaryotes. A more distantly related protein, separated from this model, is found in the archaea. It is known to bind GTP and double-stranded nucleic acid. It is suggested to belong to a nucleoprotein complex and act as a translation factor.
Probab=21.27  E-value=60  Score=30.00  Aligned_cols=20  Identities=20%  Similarity=0.569  Sum_probs=17.5

Q ss_pred             EEEeeCCeEEEEeCCCEEEe
Q 030403          139 AVVQIGSHQFKVSNGDSIFT  158 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~V  158 (178)
                      ..++..||.|-|+-||+|++
T Consensus       345 Gk~r~eGK~YivqDGDIi~f  364 (368)
T TIGR00092       345 GLMRLEGKYYVVDDGDVLFF  364 (368)
T ss_pred             CchhhcCCeEEeeCCeEEEE
Confidence            45778999999999999986


No 103
>smart00596 PRE_C2HC PRE_C2HC domain.
Probab=21.02  E-value=1.3e+02  Score=22.11  Aligned_cols=34  Identities=26%  Similarity=0.269  Sum_probs=25.3

Q ss_pred             HHHHHHHHHhCcEEecccccCccccccCCceEEE
Q 030403          107 EEKEAEAAEIGYKVLGPLRKSDRVFKKYEPAFAV  140 (178)
Q Consensus       107 ee~~~ea~~igykvvg~~~~~~~~~k~~~~MYAI  140 (178)
                      ++.+++-+++||.|.--...-.+.++....||-|
T Consensus         2 ~~I~~~L~~~G~~v~~i~~m~~~~~r~P~nmf~v   35 (69)
T smart00596        2 SQIEEALKDIGFPVLFIHNMLNRDTKNPQNMFEV   35 (69)
T ss_pred             HHHHHHHHHcCCceeEEEcccccCCCCcceeEEE
Confidence            4678889999999987766666666655667654


No 104
>PRK11171 hypothetical protein; Provisional
Probab=20.87  E-value=1.3e+02  Score=25.90  Aligned_cols=22  Identities=9%  Similarity=0.226  Sum_probs=19.1

Q ss_pred             EEEeeCCeEEEEeCCCEEEecc
Q 030403          139 AVVQIGSHQFKVSNGDSIFTER  160 (178)
Q Consensus       139 AIVeiGGKQYKV~eGD~I~VEr  160 (178)
                      +.+.++|+.|.+.+||.+++..
T Consensus        94 l~v~~~g~~~~L~~GDsi~~p~  115 (266)
T PRK11171         94 ITLTLEGKTHALSEGGYAYLPP  115 (266)
T ss_pred             EEEEECCEEEEECCCCEEEECC
Confidence            4577899999999999999874


No 105
>PF07530 PRE_C2HC:  Associated with zinc fingers;  InterPro: IPR006579 This domain is present in proteins found exclusively in the arthropods, including a number of Drosophila species, the silk moth and the gypsy moth. These proteins are possibly involved in RNA binding or single strand DNA binding.
Probab=20.81  E-value=1.5e+02  Score=21.08  Aligned_cols=33  Identities=27%  Similarity=0.134  Sum_probs=23.0

Q ss_pred             HHHHHHHHHhCcEEecccccCccccccCCceEE
Q 030403          107 EEKEAEAAEIGYKVLGPLRKSDRVFKKYEPAFA  139 (178)
Q Consensus       107 ee~~~ea~~igykvvg~~~~~~~~~k~~~~MYA  139 (178)
                      ++..++..++||+|.--...-.+..+....||=
T Consensus         2 ~~I~~~L~~~G~~v~~i~~~~~~~~k~pl~mf~   34 (68)
T PF07530_consen    2 EEIKEELKDQGHPVRNIHNMHSRNTKKPLNMFF   34 (68)
T ss_pred             HHHHHHHHHcCCceEEEEccccCCCCCCceEEE
Confidence            466788899999999766666664444455554


No 106
>smart00481 POLIIIAc DNA polymerase alpha chain like domain. DNA polymerase alpha chain like domain, incl. family of hypothetical proteins
Probab=20.49  E-value=1.1e+02  Score=20.18  Aligned_cols=27  Identities=22%  Similarity=0.247  Sum_probs=21.7

Q ss_pred             CCCCCHHHHHHHHHHhCcEEecccccC
Q 030403          101 GREYTLEEKEAEAAEIGYKVLGPLRKS  127 (178)
Q Consensus       101 ~~~~~~ee~~~ea~~igykvvg~~~~~  127 (178)
                      ....++++-.+.|++.|++.+|--.-+
T Consensus        12 ~~~~~~~~~~~~a~~~g~~~v~iTDh~   38 (67)
T smart00481       12 DGALSPEELVKRAKELGLKAIAITDHG   38 (67)
T ss_pred             cccCCHHHHHHHHHHcCCCEEEEeeCC
Confidence            345789999999999999999854443


No 107
>KOG1819 consensus FYVE finger-containing proteins [General function prediction only]
Probab=20.35  E-value=1.5e+02  Score=30.03  Aligned_cols=9  Identities=22%  Similarity=0.357  Sum_probs=4.0

Q ss_pred             CCCCCCCCC
Q 030403           64 NKNDDEGED   72 (178)
Q Consensus        64 ~~~~d~~~~   72 (178)
                      +..-|.+|+
T Consensus       419 nppad~~dg  427 (990)
T KOG1819|consen  419 NPPADNEDG  427 (990)
T ss_pred             CCccccccC
Confidence            444444444


No 108
>KOG0262 consensus RNA polymerase I, large subunit [Transcription]
Probab=20.26  E-value=45  Score=36.41  Aligned_cols=16  Identities=19%  Similarity=0.100  Sum_probs=12.0

Q ss_pred             CeEEEEeCCCEEEecc
Q 030403          145 SHQFKVSNGDSIFTER  160 (178)
Q Consensus       145 GKQYKV~eGD~I~VEr  160 (178)
                      ..+|-.+.|.+..|+.
T Consensus      1432 ~y~fd~~~~~wcev~~ 1447 (1640)
T KOG0262|consen 1432 RYTFDKESGKWCEVEL 1447 (1640)
T ss_pred             hhccccccCcEEEEEE
Confidence            5678888888877753


No 109
>PF04712 Radial_spoke:  Radial spokehead-like protein
Probab=20.24  E-value=63  Score=30.76  Aligned_cols=7  Identities=57%  Similarity=1.284  Sum_probs=4.6

Q ss_pred             Ccccccc
Q 030403           53 TNWSHYR   59 (178)
Q Consensus        53 ~~~~~~r   59 (178)
                      ..|=|++
T Consensus       334 ~~WvH~~  340 (491)
T PF04712_consen  334 SNWVHHR  340 (491)
T ss_pred             ccccccc
Confidence            4677766


No 110
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only]
Probab=20.21  E-value=47  Score=35.33  Aligned_cols=8  Identities=25%  Similarity=0.929  Sum_probs=3.6

Q ss_pred             cCC-CCccc
Q 030403           86 ESY-EGEEI   93 (178)
Q Consensus        86 ~~~-d~e~~   93 (178)
                      +++ ||||+
T Consensus       336 deYsDDeD~  344 (1233)
T KOG1824|consen  336 DEYSDDEDM  344 (1233)
T ss_pred             cccccccch
Confidence            444 44554


Done!