Query         030404
Match_columns 178
No_of_seqs    162 out of 435
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 13:13:09 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030404.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030404hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3173 Predicted Zn-finger pr 100.0 1.2E-45 2.7E-50  300.7   8.5  164    1-178     1-167 (167)
  2 smart00154 ZnF_AN1 AN1-like Zi  99.5 2.3E-15 4.9E-20   96.5   2.3   38  119-156     1-39  (39)
  3 PF01754 zf-A20:  A20-like zinc  99.5 9.4E-15   2E-19   86.0   1.8   24   19-42      2-25  (25)
  4 smart00259 ZnF_A20 A20-like zi  99.4 3.3E-14 7.1E-19   84.3   1.2   24   19-42      2-26  (26)
  5 PF01428 zf-AN1:  AN1-like Zinc  99.1 3.4E-11 7.4E-16   78.1   1.2   38  119-157     1-41  (43)
  6 COG3582 Predicted nucleic acid  96.8 0.00056 1.2E-08   56.3   1.6   38  118-156    99-137 (162)
  7 KOG3183 Predicted Zn-finger pr  96.5   0.001 2.2E-08   57.9   1.0   40  117-157     9-51  (250)
  8 PF01363 FYVE:  FYVE zinc finge  94.7   0.019 4.1E-07   39.5   1.6   29  115-143     8-39  (69)
  9 KOG3183 Predicted Zn-finger pr  93.4   0.018 3.8E-07   50.3  -0.6   41  112-152    94-138 (250)
 10 cd00065 FYVE FYVE domain; Zinc  92.6   0.052 1.1E-06   35.7   0.9   27  117-143     3-32  (57)
 11 smart00064 FYVE Protein presen  92.0   0.078 1.7E-06   36.3   1.2   29  116-144    10-41  (68)
 12 KOG1818 Membrane trafficking a  89.7    0.13 2.8E-06   50.3   0.8   47  114-160   163-223 (634)
 13 PF10571 UPF0547:  Uncharacteri  85.7    0.41 8.9E-06   28.2   1.0   22  118-139     2-24  (26)
 14 PF00130 C1_1:  Phorbol esters/  83.9    0.63 1.4E-05   30.2   1.4   24  115-138    10-37  (53)
 15 PF10122 Mu-like_Com:  Mu-like   76.1    0.95 2.1E-05   30.9   0.2   24  116-139     4-34  (51)
 16 PF15135 UPF0515:  Uncharacteri  73.9     1.7 3.7E-05   38.6   1.3   28  114-141   130-167 (278)
 17 KOG1729 FYVE finger containing  70.2     1.1 2.4E-05   40.0  -0.7   32  115-147   167-202 (288)
 18 PF02148 zf-UBP:  Zn-finger in   67.7     3.1 6.7E-05   28.4   1.2   23  119-142     1-24  (63)
 19 smart00109 C1 Protein kinase C  58.9       5 0.00011   24.7   0.9   24  115-138    10-36  (49)
 20 cd00029 C1 Protein kinase C co  58.6     5.1 0.00011   25.0   0.9   24  115-138    10-37  (50)
 21 PHA02768 hypothetical protein;  56.2     4.7  0.0001   27.8   0.5   15  127-141     2-17  (55)
 22 PF01194 RNA_pol_N:  RNA polyme  55.4     6.1 0.00013   27.8   1.0   13  116-128     4-16  (60)
 23 PF13978 DUF4223:  Protein of u  53.5     6.3 0.00014   27.3   0.8   18  139-156    19-36  (56)
 24 PF08882 Acetone_carb_G:  Aceto  52.5     6.9 0.00015   30.7   0.9   33  120-154    16-48  (112)
 25 KOG1812 Predicted E3 ubiquitin  52.3     8.8 0.00019   35.3   1.8   31  114-144   304-338 (384)
 26 PRK04016 DNA-directed RNA poly  51.0     5.8 0.00013   28.1   0.3   14  115-128     3-16  (62)
 27 COG1996 RPC10 DNA-directed RNA  50.9     6.7 0.00014   26.5   0.6   23  116-138     6-33  (49)
 28 KOG1819 FYVE finger-containing  50.2     4.6  0.0001   39.6  -0.4   30  115-144   900-932 (990)
 29 PTZ00303 phosphatidylinositol   50.2     8.3 0.00018   39.7   1.3   27  117-143   461-495 (1374)
 30 PF05207 zf-CSL:  CSL zinc fing  49.9     7.1 0.00015   26.4   0.6   12  129-140    17-28  (55)
 31 PLN00032 DNA-directed RNA poly  49.7     6.6 0.00014   28.5   0.4   13  116-128     4-16  (71)
 32 KOG2807 RNA polymerase II tran  48.3     9.9 0.00021   35.1   1.4   28  115-142   329-358 (378)
 33 PF11781 RRN7:  RNA polymerase   48.3     8.5 0.00018   24.1   0.7   22  117-138     9-34  (36)
 34 PF07649 C1_3:  C1-like domain;  48.2     7.9 0.00017   22.7   0.5   22  118-139     2-25  (30)
 35 PF03107 C1_2:  C1 domain;  Int  46.3      14 0.00031   21.8   1.5   20  118-137     2-23  (30)
 36 PF13717 zinc_ribbon_4:  zinc-r  44.7      11 0.00024   23.4   0.8    9  131-139    26-35  (36)
 37 KOG3497 DNA-directed RNA polym  44.6     7.8 0.00017   27.7   0.1   13  116-128     4-16  (69)
 38 smart00290 ZnF_UBP Ubiquitin C  44.1     8.2 0.00018   24.6   0.2   24  118-143     1-25  (50)
 39 PF14471 DUF4428:  Domain of un  42.8      12 0.00026   25.0   0.8   22  118-139     1-30  (51)
 40 smart00659 RPOLCX RNA polymera  42.6      13 0.00027   24.3   0.9   21  117-137     3-27  (44)
 41 PRK08402 replication factor A;  42.6      12 0.00025   34.3   1.0   28  117-145   213-245 (355)
 42 PHA00626 hypothetical protein   42.4      13 0.00028   26.1   1.0   23  117-141    12-35  (59)
 43 PF03604 DNA_RNApol_7kD:  DNA d  41.2      12 0.00027   22.9   0.6   19  118-136     2-24  (32)
 44 PF06750 DiS_P_DiS:  Bacterial   40.2      16 0.00035   27.1   1.3   15  115-129    32-46  (92)
 45 cd04476 RPA1_DBD_C RPA1_DBD_C:  40.0      13 0.00028   29.4   0.8   32  115-146    33-69  (166)
 46 COG1644 RPB10 DNA-directed RNA  39.7      10 0.00022   27.0   0.1   12  116-127     4-15  (63)
 47 PF07975 C1_4:  TFIIH C1-like d  39.6      12 0.00026   25.4   0.4   34  119-152     2-47  (51)
 48 PF02318 FYVE_2:  FYVE-type zin  39.6      21 0.00045   27.2   1.8   32  115-146    53-88  (118)
 49 PRK00398 rpoP DNA-directed RNA  39.6      18 0.00039   23.1   1.3   28  117-144     4-36  (46)
 50 PF13240 zinc_ribbon_2:  zinc-r  39.0      17 0.00037   20.5   1.0   20  118-137     1-21  (23)
 51 PF02928 zf-C5HC2:  C5HC2 zinc   38.8      15 0.00033   24.5   0.9   26  119-144     1-28  (54)
 52 COG1997 RPL43A Ribosomal prote  37.2      20 0.00044   27.1   1.4   35  112-146    31-70  (89)
 53 smart00647 IBR In Between Ring  35.9      24 0.00051   22.9   1.4   17  130-146    40-57  (64)
 54 PF15549 PGC7_Stella:  PGC7/Ste  35.8      19 0.00042   29.8   1.2   18  131-150   124-141 (160)
 55 COG2888 Predicted Zn-ribbon RN  35.8      13 0.00029   26.2   0.2   20  116-137    38-58  (61)
 56 PRK04136 rpl40e 50S ribosomal   35.4      19 0.00042   24.3   0.9   23  115-137    13-36  (48)
 57 COG1571 Predicted DNA-binding   34.9      18 0.00038   34.2   0.9   26  116-141   350-379 (421)
 58 PF09723 Zn-ribbon_8:  Zinc rib  34.5      24 0.00052   22.4   1.2   20  128-147     3-23  (42)
 59 PF13842 Tnp_zf-ribbon_2:  DDE_  33.8      31 0.00068   20.9   1.6   26  118-143     2-30  (32)
 60 KOG1842 FYVE finger-containing  33.3      11 0.00023   36.2  -0.8   26  116-141   180-208 (505)
 61 PF04438 zf-HIT:  HIT zinc fing  32.0      17 0.00036   21.9   0.2   23  117-142     3-26  (30)
 62 PF13248 zf-ribbon_3:  zinc-rib  32.0      27 0.00059   20.0   1.1   21  117-137     3-24  (26)
 63 PF01485 IBR:  IBR domain;  Int  31.5      20 0.00042   23.3   0.5   16  131-146    41-57  (64)
 64 PRK07218 replication factor A;  30.6      23 0.00049   33.3   0.9   21  116-138   297-318 (423)
 65 PF10367 Vps39_2:  Vacuolar sor  29.5      37  0.0008   24.1   1.7   24  116-139    78-102 (109)
 66 KOG3507 DNA-directed RNA polym  29.3      25 0.00055   24.9   0.7   23  115-137    19-45  (62)
 67 KOG0193 Serine/threonine prote  29.0      20 0.00043   35.7   0.2   50  117-171   190-243 (678)
 68 PHA00616 hypothetical protein   27.9      16 0.00035   24.1  -0.4   11  131-141     2-13  (44)
 69 PF00096 zf-C2H2:  Zinc finger,  27.6      26 0.00055   18.6   0.4    9  131-139     1-10  (23)
 70 PF00412 LIM:  LIM domain;  Int  26.7      30 0.00064   22.1   0.7   28  116-143    26-53  (58)
 71 PF08073 CHDNT:  CHDNT (NUC034)  26.7      23  0.0005   24.5   0.2   20  157-176    21-40  (55)
 72 PF14634 zf-RING_5:  zinc-RING   26.6      23 0.00051   22.2   0.2   29  118-146     1-31  (44)
 73 PRK12366 replication factor A;  25.8      29 0.00062   34.0   0.7   29  116-145   532-563 (637)
 74 PF01780 Ribosomal_L37ae:  Ribo  25.8      29 0.00063   26.2   0.6   33  113-146    32-70  (90)
 75 PF08600 Rsm1:  Rsm1-like;  Int  25.7      26 0.00057   25.8   0.3   18  116-133    19-36  (91)
 76 KOG1074 Transcriptional repres  24.6      32 0.00069   35.4   0.8   45  112-156   601-673 (958)
 77 smart00834 CxxC_CXXC_SSSS Puta  23.5      38 0.00083   20.4   0.7   12  129-140     4-16  (41)
 78 PF14835 zf-RING_6:  zf-RING of  23.0      46 0.00099   23.8   1.1   27  116-142     7-33  (65)
 79 smart00396 ZnF_UBR1 Putative z  21.7      50  0.0011   23.2   1.1   13  131-143    51-70  (71)
 80 smart00508 PostSET Cysteine-ri  21.1      50  0.0011   19.5   0.8   11  131-141     3-13  (26)
 81 COG3357 Predicted transcriptio  20.9      35 0.00077   26.1   0.2   18  124-141    52-70  (97)
 82 PF01927 Mut7-C:  Mut7-C RNAse   20.7      50  0.0011   26.0   1.0   11  116-126    91-101 (147)
 83 PF13465 zf-H2C2_2:  Zinc-finge  20.4      56  0.0012   18.4   0.9   10  130-139    14-24  (26)
 84 PF07282 OrfB_Zn_ribbon:  Putat  20.4      67  0.0015   21.6   1.5   24  115-138    27-55  (69)
 85 PRK08197 threonine synthase; V  20.3      46   0.001   30.1   0.8   31  116-146     7-39  (394)

No 1  
>KOG3173 consensus Predicted Zn-finger protein [General function prediction only]
Probab=100.00  E-value=1.2e-45  Score=300.68  Aligned_cols=164  Identities=39%  Similarity=0.757  Sum_probs=107.6

Q ss_pred             CCccccccccccCCCcccccccccCCCcCCccCCCchhhhhhhhhhhhccc-ccCC-CCCCCCCCCCCcccccccccccc
Q 030404            1 MAQKTEKEETEFKVPETLTLCVNNCGFTGNPATNNMCQKCFNATATTTASA-VAGS-STGGGGGGGSGVAIIKFSSEKSL   78 (178)
Q Consensus         1 Ma~~~~~~~pe~~~p~~~~lC~ngCGFfGs~at~n~CSkCyr~~~~~~~~~-~~~~-~~~~~~~~~~~~~~~~~~~~~~~   78 (178)
                      |+++.....+.   ++.+.||.|||||||+|+|+||||+||++++.++++. ...+ .+...+. ++   ...+..+...
T Consensus         1 M~~e~~~~~~~---~~~~~lc~~gCGf~G~p~~~n~CSkC~~e~~~~~~~~~~~~~~~~~~~~~-~~---~s~~~~~~~~   73 (167)
T KOG3173|consen    1 MASETNGSQTP---PSQDLLCVNGCGFYGSPATENLCSKCYRDHLLRQQQKQARASPPVESSLS-SP---RSVPSRDPPA   73 (167)
T ss_pred             CcccccCCCCC---CccccccccCccccCChhhccHHHHHHHHHHHHhhhccccccCccccccc-Cc---cccCcccccc
Confidence            77765553322   2245899999999999999999999999999877665 2211 1111100 00   0001000000


Q ss_pred             ccccccccCCCC-CCCCCCcccchhhhhhhhhhhccccCCccccccccccccceeeecCccccccCCCCCCCCCCccchH
Q 030404           79 RSRPIIRSGSSD-AAGTTGQNQELTDRREKEANVEKRVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKS  157 (178)
Q Consensus        79 ~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~rC~~C~kkvgl~gf~CrCg~~FC~~HRy~e~H~C~fDyk~  157 (178)
                        .........+ ......   +..  ...........++||+.|+|||||+||.||||++||+.|||||.|+|+||||.
T Consensus        74 --~~~~~~~~~~~~~~~~~---~s~--~~~~~~~~~~~~~rC~~C~kk~gltgf~CrCG~~fC~~HRy~e~H~C~fDyK~  146 (167)
T KOG3173|consen   74 --VSLESTTESELKLVSDT---PST--EEEDEESKPKKKKRCFKCRKKVGLTGFKCRCGNTFCGTHRYPEQHDCSFDYKQ  146 (167)
T ss_pred             --ccccccccccccccccC---Ccc--cccccccccccchhhhhhhhhhcccccccccCCcccccccCCccccccccHHH
Confidence              0000000000 000000   000  01112233456789999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHhCCcccccccccC
Q 030404          158 AGRDAIARENPVIKAAKIVRV  178 (178)
Q Consensus       158 ~~r~~l~k~NP~v~~~Kl~ki  178 (178)
                      +||+.|+++||+|+++||.||
T Consensus       147 ~gr~~i~k~nP~v~a~k~~ki  167 (167)
T KOG3173|consen  147 AGREKIAKANPVVKADKLQKI  167 (167)
T ss_pred             HHHHHHHHhCCeeeccccccC
Confidence            999999999999999999998


No 2  
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=99.54  E-value=2.3e-15  Score=96.52  Aligned_cols=38  Identities=71%  Similarity=1.547  Sum_probs=36.8

Q ss_pred             cccccccccccceeee-cCccccccCCCCCCCCCCccch
Q 030404          119 CSGCRRKVGLTGFRCR-CGELFCGEHRYSDRHDCSYDYK  156 (178)
Q Consensus       119 C~~C~kkvgl~gf~Cr-Cg~~FC~~HRy~e~H~C~fDyk  156 (178)
                      |+.|+++++|++|+|+ |+++||..|||||.|+|++|||
T Consensus         1 C~~C~~~~~l~~f~C~~C~~~FC~~HR~~e~H~C~~~~k   39 (39)
T smart00154        1 CHFCRKKVGLTGFKCRHCGNLFCGEHRLPEDHDCPGDYK   39 (39)
T ss_pred             CcccCCcccccCeECCccCCccccccCCccccCCccccC
Confidence            7899999999999999 9999999999999999999996


No 3  
>PF01754 zf-A20:  A20-like zinc finger;  InterPro: IPR002653 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in A20. A20 is an inhibitor of cell death that inhibits NF-kappaB activation via the tumour necrosis factor receptor associated factor pathway []. The zinc finger domains appear to mediate self-association in A20. These fingers also mediate IL-1-induced NF-kappa B activation. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 2FIF_F 2FID_B 2C7N_C 2C7M_A 2L00_A 2KZY_A 2EQG_A 2EQE_A 3OJ3_J 3OJ4_C ....
Probab=99.49  E-value=9.4e-15  Score=85.97  Aligned_cols=24  Identities=58%  Similarity=1.432  Sum_probs=20.2

Q ss_pred             ccccccCCCcCCccCCCchhhhhh
Q 030404           19 TLCVNNCGFTGNPATNNMCQKCFN   42 (178)
Q Consensus        19 ~lC~ngCGFfGs~at~n~CSkCyr   42 (178)
                      .+|++|||||||++|+||||+|||
T Consensus         2 ~~C~~gCgf~Gs~~~~~~Cs~C~~   25 (25)
T PF01754_consen    2 SLCANGCGFYGSPATNGLCSKCYR   25 (25)
T ss_dssp             SB-TTTSSSB-BGGGTTS-HHHHH
T ss_pred             CcccCCCCCcccccccCcchhhcC
Confidence            789999999999999999999997


No 4  
>smart00259 ZnF_A20 A20-like zinc fingers. A20- (an inhibitor of cell death)-like zinc fingers. The zinc finger mediates self-association in A20. These fingers also mediate IL-1-induced NF-kappaB activation.
Probab=99.43  E-value=3.3e-14  Score=84.31  Aligned_cols=24  Identities=54%  Similarity=1.254  Sum_probs=23.0

Q ss_pred             cccc-ccCCCcCCccCCCchhhhhh
Q 030404           19 TLCV-NNCGFTGNPATNNMCQKCFN   42 (178)
Q Consensus        19 ~lC~-ngCGFfGs~at~n~CSkCyr   42 (178)
                      ++|. +||||||||+|+||||||||
T Consensus         2 ~~C~~~~CgF~G~~~t~~~CskCy~   26 (26)
T smart00259        2 IKCRRPGCGFFGNPATEGLCSKCFK   26 (26)
T ss_pred             CccccCCCCCcCChhhcccCHhhcC
Confidence            6899 99999999999999999996


No 5  
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=99.08  E-value=3.4e-11  Score=78.07  Aligned_cols=38  Identities=42%  Similarity=0.919  Sum_probs=28.0

Q ss_pred             ccc--ccccccccceeee-cCccccccCCCCCCCCCCccchH
Q 030404          119 CSG--CRRKVGLTGFRCR-CGELFCGEHRYSDRHDCSYDYKS  157 (178)
Q Consensus       119 C~~--C~kkvgl~gf~Cr-Cg~~FC~~HRy~e~H~C~fDyk~  157 (178)
                      |..  |++++. ++|.|+ |+..||..||||+.|+|+++++.
T Consensus         1 C~~~~C~~~~~-~~~~C~~C~~~FC~~Hr~~e~H~C~~~~~~   41 (43)
T PF01428_consen    1 CSFPGCKKKDF-LPFKCKHCGKSFCLKHRLPEDHNCSKLQKK   41 (43)
T ss_dssp             -SSTTT--BCT-SHEE-TTTS-EE-TTTHSTTTCT-SSTTSC
T ss_pred             CccCcCcCccC-CCeECCCCCcccCccccCccccCCcchhhc
Confidence            444  998887 789999 99999999999999999999874


No 6  
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only]
Probab=96.82  E-value=0.00056  Score=56.32  Aligned_cols=38  Identities=29%  Similarity=0.565  Sum_probs=30.7

Q ss_pred             ccccccccccccceeee-cCccccccCCCCCCCCCCccch
Q 030404          118 RCSGCRRKVGLTGFRCR-CGELFCGEHRYSDRHDCSYDYK  156 (178)
Q Consensus       118 rC~~C~kkvgl~gf~Cr-Cg~~FC~~HRy~e~H~C~fDyk  156 (178)
                      +|..|++..+|. ++|- |++.||+.||+++.|+|.+...
T Consensus        99 ~~~~~g~~s~l~-~~c~~c~g~fc~~h~lp~nhdc~~L~s  137 (162)
T COG3582          99 TPQCTGKGSTLA-GKCNYCTGYFCAEHRLPENHDCNGLGS  137 (162)
T ss_pred             cceeccCCcccc-ccccCCCCcceeceecccccccccHHH
Confidence            444556655555 8997 9999999999999999998854


No 7  
>KOG3183 consensus Predicted Zn-finger protein [General function prediction only]
Probab=96.47  E-value=0.001  Score=57.92  Aligned_cols=40  Identities=33%  Similarity=0.890  Sum_probs=34.8

Q ss_pred             Cccc--cccccccccceeee-cCccccccCCCCCCCCCCccchH
Q 030404          117 NRCS--GCRRKVGLTGFRCR-CGELFCGEHRYSDRHDCSYDYKS  157 (178)
Q Consensus       117 ~rC~--~C~kkvgl~gf~Cr-Cg~~FC~~HRy~e~H~C~fDyk~  157 (178)
                      ..|.  .|+ ++.++.|+|- |+.+||..||-.+.|.|.+.|..
T Consensus         9 kHCs~~~Ck-qlDFLPf~Cd~C~~~FC~eHrsye~H~Cp~~~~~   51 (250)
T KOG3183|consen    9 KHCSVPYCK-QLDFLPFKCDGCSGIFCLEHRSYESHHCPKGLRI   51 (250)
T ss_pred             cccCcchhh-hccccceeeCCccchhhhccchHhhcCCCccccc
Confidence            4677  776 6778999996 99999999999999999998764


No 8  
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=94.66  E-value=0.019  Score=39.48  Aligned_cols=29  Identities=31%  Similarity=0.811  Sum_probs=17.5

Q ss_pred             cCCcccccccccccc--ceeee-cCccccccC
Q 030404          115 VVNRCSGCRRKVGLT--GFRCR-CGELFCGEH  143 (178)
Q Consensus       115 ~~~rC~~C~kkvgl~--gf~Cr-Cg~~FC~~H  143 (178)
                      ....|..|+++.+|+  -..|| ||.+||+.+
T Consensus         8 ~~~~C~~C~~~F~~~~rrhhCr~CG~~vC~~C   39 (69)
T PF01363_consen    8 EASNCMICGKKFSLFRRRHHCRNCGRVVCSSC   39 (69)
T ss_dssp             G-SB-TTT--B-BSSS-EEE-TTT--EEECCC
T ss_pred             CCCcCcCcCCcCCCceeeEccCCCCCEECCch
Confidence            357999999999996  49999 999999754


No 9  
>KOG3183 consensus Predicted Zn-finger protein [General function prediction only]
Probab=93.39  E-value=0.018  Score=50.34  Aligned_cols=41  Identities=34%  Similarity=0.867  Sum_probs=34.5

Q ss_pred             ccccCCccc--ccccccccc-ceeee-cCccccccCCCCCCCCCC
Q 030404          112 EKRVVNRCS--GCRRKVGLT-GFRCR-CGELFCGEHRYSDRHDCS  152 (178)
Q Consensus       112 ~~~~~~rC~--~C~kkvgl~-gf~Cr-Cg~~FC~~HRy~e~H~C~  152 (178)
                      .+...++|.  .|++++-+. .+.|+ ||..||-+||++-.|.|.
T Consensus        94 ~k~~t~kc~~~~c~k~~~~~~~~~c~~c~~~~c~khr~~~dhsc~  138 (250)
T KOG3183|consen   94 RKVFTNKCPVPRCKKTLTLANKITCSKCGRNFCLKHRHPLDHSCN  138 (250)
T ss_pred             cccccccCCchhhHHHHHHHHhhhhHhhcchhhhhccCCCCchhh
Confidence            345567776  688888775 69998 999999999999999998


No 10 
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=92.65  E-value=0.052  Score=35.74  Aligned_cols=27  Identities=41%  Similarity=1.126  Sum_probs=23.5

Q ss_pred             Ccccccccccccc--ceeee-cCccccccC
Q 030404          117 NRCSGCRRKVGLT--GFRCR-CGELFCGEH  143 (178)
Q Consensus       117 ~rC~~C~kkvgl~--gf~Cr-Cg~~FC~~H  143 (178)
                      ..|..|+++.++.  ...|| ||.+||+.+
T Consensus         3 ~~C~~C~~~F~~~~rk~~Cr~Cg~~~C~~C   32 (57)
T cd00065           3 SSCMGCGKPFTLTRRRHHCRNCGRIFCSKC   32 (57)
T ss_pred             CcCcccCccccCCccccccCcCcCCcChHH
Confidence            5799999999996  69998 999999854


No 11 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG1818 consensus Membrane trafficking and cell signaling protein HRS, contains VHS and FYVE domains [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=89.75  E-value=0.13  Score=50.33  Aligned_cols=47  Identities=36%  Similarity=0.756  Sum_probs=36.4

Q ss_pred             ccCCccccccccccccc--eeee-cCccccccCC-----------CCCCCCCCccchHhhH
Q 030404          114 RVVNRCSGCRRKVGLTG--FRCR-CGELFCGEHR-----------YSDRHDCSYDYKSAGR  160 (178)
Q Consensus       114 ~~~~rC~~C~kkvgl~g--f~Cr-Cg~~FC~~HR-----------y~e~H~C~fDyk~~~r  160 (178)
                      .....|..|+.+.|+++  ..|| ||.+||+.|=           |-+.--|..||...-|
T Consensus       163 ~D~~~C~rCr~~F~~~~rkHHCr~CG~vFC~qcss~s~~lP~~Gi~~~VRVCd~C~E~l~~  223 (634)
T KOG1818|consen  163 IDSEECLRCRVKFGLTNRKHHCRNCGQVFCGQCSSKSLTLPKLGIEKPVRVCDSCYELLTR  223 (634)
T ss_pred             ccccccceeeeeeeeccccccccccchhhccCccccccCcccccccccceehhhhHHHhhh
Confidence            34679999999999985  8999 9999999874           3455667777764433


No 13 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=85.71  E-value=0.41  Score=28.18  Aligned_cols=22  Identities=32%  Similarity=0.690  Sum_probs=19.8

Q ss_pred             ccccccccccccceeee-cCccc
Q 030404          118 RCSGCRRKVGLTGFRCR-CGELF  139 (178)
Q Consensus       118 rC~~C~kkvgl~gf~Cr-Cg~~F  139 (178)
                      +|-.|++.|.+.--.|- ||+.|
T Consensus         2 ~CP~C~~~V~~~~~~Cp~CG~~F   24 (26)
T PF10571_consen    2 TCPECGAEVPESAKFCPHCGYDF   24 (26)
T ss_pred             cCCCCcCCchhhcCcCCCCCCCC
Confidence            68999999999989997 99887


No 14 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=83.94  E-value=0.63  Score=30.18  Aligned_cols=24  Identities=33%  Similarity=0.919  Sum_probs=18.6

Q ss_pred             cCCccccccccc---cccceeee-cCcc
Q 030404          115 VVNRCSGCRRKV---GLTGFRCR-CGEL  138 (178)
Q Consensus       115 ~~~rC~~C~kkv---gl~gf~Cr-Cg~~  138 (178)
                      .+..|..|++.+   ++.|++|+ |+.+
T Consensus        10 ~~~~C~~C~~~i~g~~~~g~~C~~C~~~   37 (53)
T PF00130_consen   10 KPTYCDVCGKFIWGLGKQGYRCSWCGLV   37 (53)
T ss_dssp             STEB-TTSSSBECSSSSCEEEETTTT-E
T ss_pred             CCCCCcccCcccCCCCCCeEEECCCCCh
Confidence            567999999999   56799998 8765


No 15 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=76.09  E-value=0.95  Score=30.94  Aligned_cols=24  Identities=25%  Similarity=0.733  Sum_probs=18.5

Q ss_pred             CCcccccccccccc------ceee-ecCccc
Q 030404          116 VNRCSGCRRKVGLT------GFRC-RCGELF  139 (178)
Q Consensus       116 ~~rC~~C~kkvgl~------gf~C-rCg~~F  139 (178)
                      .-||..|+|.|...      -++| |||.++
T Consensus         4 eiRC~~CnklLa~~g~~~~leIKCpRC~tiN   34 (51)
T PF10122_consen    4 EIRCGHCNKLLAKAGEVIELEIKCPRCKTIN   34 (51)
T ss_pred             ceeccchhHHHhhhcCccEEEEECCCCCccc
Confidence            46999999998774      3788 688664


No 16 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=73.85  E-value=1.7  Score=38.62  Aligned_cols=28  Identities=39%  Similarity=1.062  Sum_probs=22.4

Q ss_pred             ccCCcccccccc---------ccccceee-ecCccccc
Q 030404          114 RVVNRCSGCRRK---------VGLTGFRC-RCGELFCG  141 (178)
Q Consensus       114 ~~~~rC~~C~kk---------vgl~gf~C-rCg~~FC~  141 (178)
                      +..+||..|+||         .|+.-|.| .|+.+|=+
T Consensus       130 KeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G  167 (278)
T PF15135_consen  130 KEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRG  167 (278)
T ss_pred             cccccccccccccCCCccccccceeeeecccccccchh
Confidence            456899999998         56666999 59999954


No 17 
>KOG1729 consensus FYVE finger containing protein [General function prediction only]
Probab=70.24  E-value=1.1  Score=39.97  Aligned_cols=32  Identities=25%  Similarity=0.709  Sum_probs=26.4

Q ss_pred             cCCccccccc-ccccc--ceeee-cCccccccCCCCC
Q 030404          115 VVNRCSGCRR-KVGLT--GFRCR-CGELFCGEHRYSD  147 (178)
Q Consensus       115 ~~~rC~~C~k-kvgl~--gf~Cr-Cg~~FC~~HRy~e  147 (178)
                      ..++|..|.+ .-.|+  --.|| ||.+||. |.-..
T Consensus       167 ea~~C~~C~~~~Ftl~~RRHHCR~CG~ivC~-~Cs~n  202 (288)
T KOG1729|consen  167 EATECMVCGCTEFTLSERRHHCRNCGDIVCA-PCSRN  202 (288)
T ss_pred             cceecccCCCccccHHHHHHHHHhcchHhhh-hhhcC
Confidence            4689999999 77775  48899 9999999 87544


No 18 
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=67.68  E-value=3.1  Score=28.37  Aligned_cols=23  Identities=35%  Similarity=0.817  Sum_probs=15.0

Q ss_pred             cccccccccccceeee-cCcccccc
Q 030404          119 CSGCRRKVGLTGFRCR-CGELFCGE  142 (178)
Q Consensus       119 C~~C~kkvgl~gf~Cr-Cg~~FC~~  142 (178)
                      |..|+.. +-.-+.|- ||.++|+.
T Consensus         1 C~~C~~~-~~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    1 CSVCGST-NSNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             -SSSHTC-SSSEEEETTTS-EEETT
T ss_pred             CCCCCCc-CCceEEeCCCCcccccC
Confidence            5667755 33447886 99999994


No 19 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=58.86  E-value=5  Score=24.73  Aligned_cols=24  Identities=29%  Similarity=0.753  Sum_probs=18.8

Q ss_pred             cCCcccccccccccc--ceeee-cCcc
Q 030404          115 VVNRCSGCRRKVGLT--GFRCR-CGEL  138 (178)
Q Consensus       115 ~~~rC~~C~kkvgl~--gf~Cr-Cg~~  138 (178)
                      .+..|..|++.+...  |++|+ |+.+
T Consensus        10 ~~~~C~~C~~~i~~~~~~~~C~~C~~~   36 (49)
T smart00109       10 KPTKCCVCRKSIWGSFQGLRCSWCKVK   36 (49)
T ss_pred             CCCCccccccccCcCCCCcCCCCCCch
Confidence            367899999999873  89998 7543


No 20 
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=58.59  E-value=5.1  Score=25.01  Aligned_cols=24  Identities=29%  Similarity=0.656  Sum_probs=19.2

Q ss_pred             cCCccccccccccc---cceeee-cCcc
Q 030404          115 VVNRCSGCRRKVGL---TGFRCR-CGEL  138 (178)
Q Consensus       115 ~~~rC~~C~kkvgl---~gf~Cr-Cg~~  138 (178)
                      .+..|..|++.+..   .|++|+ |+.+
T Consensus        10 ~~~~C~~C~~~i~~~~~~~~~C~~C~~~   37 (50)
T cd00029          10 KPTFCDVCRKSIWGLFKQGLRCSWCKVK   37 (50)
T ss_pred             CCCChhhcchhhhccccceeEcCCCCCc
Confidence            36789999999985   689998 7654


No 21 
>PHA02768 hypothetical protein; Provisional
Probab=56.16  E-value=4.7  Score=27.83  Aligned_cols=15  Identities=40%  Similarity=1.183  Sum_probs=11.8

Q ss_pred             cccceeee-cCccccc
Q 030404          127 GLTGFRCR-CGELFCG  141 (178)
Q Consensus       127 gl~gf~Cr-Cg~~FC~  141 (178)
                      .|+||.|- ||..|-.
T Consensus         2 ~~~~y~C~~CGK~Fs~   17 (55)
T PHA02768          2 ALLGYECPICGEIYIK   17 (55)
T ss_pred             cccccCcchhCCeecc
Confidence            47889996 9888864


No 22 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=55.42  E-value=6.1  Score=27.78  Aligned_cols=13  Identities=31%  Similarity=0.680  Sum_probs=10.0

Q ss_pred             CCccccccccccc
Q 030404          116 VNRCSGCRRKVGL  128 (178)
Q Consensus       116 ~~rC~~C~kkvgl  128 (178)
                      |-||++|+|-+|-
T Consensus         4 PVRCFTCGkvi~~   16 (60)
T PF01194_consen    4 PVRCFTCGKVIGN   16 (60)
T ss_dssp             SSS-STTTSBTCG
T ss_pred             ceecCCCCCChhH
Confidence            6799999998863


No 23 
>PF13978 DUF4223:  Protein of unknown function (DUF4223)
Probab=53.48  E-value=6.3  Score=27.27  Aligned_cols=18  Identities=39%  Similarity=0.835  Sum_probs=16.1

Q ss_pred             ccccCCCCCCCCCCccch
Q 030404          139 FCGEHRYSDRHDCSYDYK  156 (178)
Q Consensus       139 FC~~HRy~e~H~C~fDyk  156 (178)
                      -|--|-|-.+.+|+|||-
T Consensus        19 ~CTG~v~Nk~knCsYDYl   36 (56)
T PF13978_consen   19 ACTGHVENKEKNCSYDYL   36 (56)
T ss_pred             hccceeeccCCCCcceee
Confidence            477899999999999995


No 24 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=52.49  E-value=6.9  Score=30.72  Aligned_cols=33  Identities=21%  Similarity=0.364  Sum_probs=24.1

Q ss_pred             ccccccccccceeeecCccccccCCCCCCCCCCcc
Q 030404          120 SGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYD  154 (178)
Q Consensus       120 ~~C~kkvgl~gf~CrCg~~FC~~HRy~e~H~C~fD  154 (178)
                      +.|+++-.  -.+|+||+.||+-+.--..|.--++
T Consensus        16 ~i~~~~~k--~vkc~CGh~f~d~r~NwK~~alv~v   48 (112)
T PF08882_consen   16 WIVQKKDK--VVKCDCGHEFCDARENWKLGALVYV   48 (112)
T ss_pred             EEEEecCc--eeeccCCCeecChhcChhhCcEEEe
Confidence            55665542  5899999999999887777765444


No 25 
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=52.34  E-value=8.8  Score=35.30  Aligned_cols=31  Identities=29%  Similarity=0.774  Sum_probs=25.9

Q ss_pred             ccCCccccccccccccc----eeeecCccccccCC
Q 030404          114 RVVNRCSGCRRKVGLTG----FRCRCGELFCGEHR  144 (178)
Q Consensus       114 ~~~~rC~~C~kkvgl~g----f~CrCg~~FC~~HR  144 (178)
                      +.-.+|..|+-.+-|.+    ++||||.-||..=.
T Consensus       304 ~~wr~CpkC~~~ie~~~GCnhm~CrC~~~fcy~C~  338 (384)
T KOG1812|consen  304 KRWRQCPKCKFMIELSEGCNHMTCRCGHQFCYMCG  338 (384)
T ss_pred             HhcCcCcccceeeeecCCcceEEeeccccchhhcC
Confidence            45689999999988863    99999999997655


No 26 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=51.01  E-value=5.8  Score=28.07  Aligned_cols=14  Identities=21%  Similarity=0.565  Sum_probs=11.3

Q ss_pred             cCCccccccccccc
Q 030404          115 VVNRCSGCRRKVGL  128 (178)
Q Consensus       115 ~~~rC~~C~kkvgl  128 (178)
                      .|-||++|+|-+|-
T Consensus         3 iPvRCFTCGkvi~~   16 (62)
T PRK04016          3 IPVRCFTCGKVIAE   16 (62)
T ss_pred             CCeEecCCCCChHH
Confidence            36799999998864


No 27 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=50.88  E-value=6.7  Score=26.54  Aligned_cols=23  Identities=43%  Similarity=1.057  Sum_probs=18.3

Q ss_pred             CCcccccccccccc----ceeee-cCcc
Q 030404          116 VNRCSGCRRKVGLT----GFRCR-CGEL  138 (178)
Q Consensus       116 ~~rC~~C~kkvgl~----gf~Cr-Cg~~  138 (178)
                      ..+|..|++++-++    +..|. ||+-
T Consensus         6 ~Y~C~~Cg~~~~~~~~~~~irCp~Cg~r   33 (49)
T COG1996           6 EYKCARCGREVELDQETRGIRCPYCGSR   33 (49)
T ss_pred             EEEhhhcCCeeehhhccCceeCCCCCcE
Confidence            47899999999853    79997 7654


No 28 
>KOG1819 consensus FYVE finger-containing proteins [General function prediction only]
Probab=50.23  E-value=4.6  Score=39.57  Aligned_cols=30  Identities=30%  Similarity=0.873  Sum_probs=22.0

Q ss_pred             cCCcccccccccccc--ceeee-cCccccccCC
Q 030404          115 VVNRCSGCRRKVGLT--GFRCR-CGELFCGEHR  144 (178)
Q Consensus       115 ~~~rC~~C~kkvgl~--gf~Cr-Cg~~FC~~HR  144 (178)
                      ..-+|..|.......  -..|| ||++||++--
T Consensus       900 ~a~~cmacq~pf~afrrrhhcrncggifcg~cs  932 (990)
T KOG1819|consen  900 DAEQCMACQMPFNAFRRRHHCRNCGGIFCGKCS  932 (990)
T ss_pred             cchhhhhccCcHHHHHHhhhhcccCceeecccc
Confidence            457899998654442  36899 9999998743


No 29 
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=50.17  E-value=8.3  Score=39.65  Aligned_cols=27  Identities=30%  Similarity=0.714  Sum_probs=21.1

Q ss_pred             Cccccccccccc-------cceeee-cCccccccC
Q 030404          117 NRCSGCRRKVGL-------TGFRCR-CGELFCGEH  143 (178)
Q Consensus       117 ~rC~~C~kkvgl-------~gf~Cr-Cg~~FC~~H  143 (178)
                      ..|..|+++-+.       .--.|| ||.+||+..
T Consensus       461 dtC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~C  495 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFC  495 (1374)
T ss_pred             CcccCcCCcccccccccccccccccCCccccCccc
Confidence            579999999864       246699 999998653


No 30 
>PF05207 zf-CSL:  CSL zinc finger;  InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a probable zinc binding motif that contains four cysteines and may chelate zinc, known as the DPH-type after the diphthamide (DPH) biosynthesis protein in which it was first characterised, including the proteins DPH3 and DPH4. This domain is also found associated with N-terminal domain of heat shock protein DnaJ IPR001623 from INTERPRO domain.  Diphthamide is a unique post-translationally modified histidine residue found only in translation elongation factor 2 (eEF-2). It is conserved from archaea to humans and serves as the target for diphteria toxin and Pseudomonas exotoxin A. These two toxins catalyse the transfer of ADP-ribose to diphtamide on eEF-2, thus inactivating eEF-2, halting cellular protein synthesis, and causing cell death []. The biosynthesis of diphtamide is dependent on at least five proteins, DPH1 to -5, and a still unidentified amidating enzyme. DPH3 and DPH4 share a conserved region, which encode a putative zinc finger, the DPH-type or CSL-type (after the conserved motif of the final cysteine) zinc finger [, ]. The function of this motif is unknown. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2L6L_A 1WGE_A 2JR7_A 1YOP_A 1YWS_A.
Probab=49.85  E-value=7.1  Score=26.43  Aligned_cols=12  Identities=42%  Similarity=1.038  Sum_probs=9.8

Q ss_pred             cceeeecCcccc
Q 030404          129 TGFRCRCGELFC  140 (178)
Q Consensus       129 ~gf~CrCg~~FC  140 (178)
                      .-+.||||..|-
T Consensus        17 ~~y~CRCG~~f~   28 (55)
T PF05207_consen   17 YSYPCRCGGEFE   28 (55)
T ss_dssp             EEEEETTSSEEE
T ss_pred             EEEcCCCCCEEE
Confidence            458999999875


No 31 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=49.68  E-value=6.6  Score=28.54  Aligned_cols=13  Identities=31%  Similarity=0.680  Sum_probs=10.9

Q ss_pred             CCccccccccccc
Q 030404          116 VNRCSGCRRKVGL  128 (178)
Q Consensus       116 ~~rC~~C~kkvgl  128 (178)
                      |-||++|+|-+|-
T Consensus         4 PVRCFTCGkvig~   16 (71)
T PLN00032          4 PVRCFTCGKVIGN   16 (71)
T ss_pred             ceeecCCCCCcHH
Confidence            6799999998764


No 32 
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=48.34  E-value=9.9  Score=35.14  Aligned_cols=28  Identities=25%  Similarity=0.719  Sum_probs=22.9

Q ss_pred             cCCccccc-cccccccceeee-cCcccccc
Q 030404          115 VVNRCSGC-RRKVGLTGFRCR-CGELFCGE  142 (178)
Q Consensus       115 ~~~rC~~C-~kkvgl~gf~Cr-Cg~~FC~~  142 (178)
                      ..++|+.| .+.++-..|.|+ |-++||-.
T Consensus       329 ~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCld  358 (378)
T KOG2807|consen  329 GSRFCFACQGELLSSGRYRCESCKNVFCLD  358 (378)
T ss_pred             CCcceeeeccccCCCCcEEchhccceeecc
Confidence            46789999 666666789998 99999964


No 33 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=48.29  E-value=8.5  Score=24.09  Aligned_cols=22  Identities=32%  Similarity=0.883  Sum_probs=17.6

Q ss_pred             Ccccccccccccc--c-eee-ecCcc
Q 030404          117 NRCSGCRRKVGLT--G-FRC-RCGEL  138 (178)
Q Consensus       117 ~rC~~C~kkvgl~--g-f~C-rCg~~  138 (178)
                      -+|..|+-+...+  | |.| +||.+
T Consensus         9 ~~C~~C~~~~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen    9 EPCPVCGSRWFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             CcCCCCCCeEeEccCCEEEhhhCceE
Confidence            4699999997775  3 899 89875


No 34 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=48.22  E-value=7.9  Score=22.71  Aligned_cols=22  Identities=27%  Similarity=0.708  Sum_probs=8.7

Q ss_pred             ccccccccccc-cceeee-cCccc
Q 030404          118 RCSGCRRKVGL-TGFRCR-CGELF  139 (178)
Q Consensus       118 rC~~C~kkvgl-~gf~Cr-Cg~~F  139 (178)
                      +|..|++.+.. ..|.|. |...+
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~Cdf~l   25 (30)
T PF07649_consen    2 RCDACGKPIDGGWFYRCSECDFDL   25 (30)
T ss_dssp             --TTTS----S--EEE-TTT----
T ss_pred             cCCcCCCcCCCCceEECccCCCcc
Confidence            68999999988 779997 76654


No 35 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=46.29  E-value=14  Score=21.75  Aligned_cols=20  Identities=35%  Similarity=0.753  Sum_probs=16.5

Q ss_pred             cccccccccccc-ceeee-cCc
Q 030404          118 RCSGCRRKVGLT-GFRCR-CGE  137 (178)
Q Consensus       118 rC~~C~kkvgl~-gf~Cr-Cg~  137 (178)
                      .|..|++++.-. .|.|. |+.
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~c~f   23 (30)
T PF03107_consen    2 WCDVCRRKIDGFYFYHCSECCF   23 (30)
T ss_pred             CCCCCCCCcCCCEeEEeCCCCC
Confidence            489999999888 89996 653


No 36 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=44.72  E-value=11  Score=23.35  Aligned_cols=9  Identities=56%  Similarity=1.604  Sum_probs=5.2

Q ss_pred             eeee-cCccc
Q 030404          131 FRCR-CGELF  139 (178)
Q Consensus       131 f~Cr-Cg~~F  139 (178)
                      .+|. ||.+|
T Consensus        26 v~C~~C~~~f   35 (36)
T PF13717_consen   26 VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEe
Confidence            5664 66655


No 37 
>KOG3497 consensus DNA-directed RNA polymerase, subunit RPB10 [Transcription]
Probab=44.57  E-value=7.8  Score=27.72  Aligned_cols=13  Identities=31%  Similarity=0.639  Sum_probs=10.9

Q ss_pred             CCccccccccccc
Q 030404          116 VNRCSGCRRKVGL  128 (178)
Q Consensus       116 ~~rC~~C~kkvgl  128 (178)
                      |-||++|+|-+|-
T Consensus         4 PiRCFtCGKvig~   16 (69)
T KOG3497|consen    4 PIRCFTCGKVIGD   16 (69)
T ss_pred             eeEeeeccccccc
Confidence            6799999998764


No 38 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=44.10  E-value=8.2  Score=24.56  Aligned_cols=24  Identities=38%  Similarity=0.844  Sum_probs=17.6

Q ss_pred             ccccccccccccceeee-cCccccccC
Q 030404          118 RCSGCRRKVGLTGFRCR-CGELFCGEH  143 (178)
Q Consensus       118 rC~~C~kkvgl~gf~Cr-Cg~~FC~~H  143 (178)
                      ||..|.....  -+.|- |+.++|+..
T Consensus         1 ~C~~C~~~~~--l~~CL~C~~~~c~~~   25 (50)
T smart00290        1 RCSVCGTIEN--LWLCLTCGQVGCGRY   25 (50)
T ss_pred             CcccCCCcCC--eEEecCCCCcccCCC
Confidence            6888886554  36775 999999764


No 39 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=42.85  E-value=12  Score=25.05  Aligned_cols=22  Identities=36%  Similarity=1.065  Sum_probs=16.3

Q ss_pred             cccccccccccc-------ceeee-cCccc
Q 030404          118 RCSGCRRKVGLT-------GFRCR-CGELF  139 (178)
Q Consensus       118 rC~~C~kkvgl~-------gf~Cr-Cg~~F  139 (178)
                      +|..|++++||+       ||-|. |-...
T Consensus         1 ~C~iCg~kigl~~~~k~~DG~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDGYICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCccchHHHHHHh
Confidence            599999999996       46776 64333


No 40 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=42.63  E-value=13  Score=24.27  Aligned_cols=21  Identities=38%  Similarity=0.899  Sum_probs=15.4

Q ss_pred             Ccccccccccccc---ceeee-cCc
Q 030404          117 NRCSGCRRKVGLT---GFRCR-CGE  137 (178)
Q Consensus       117 ~rC~~C~kkvgl~---gf~Cr-Cg~  137 (178)
                      .+|..|+..+.+.   +.+|+ ||+
T Consensus         3 Y~C~~Cg~~~~~~~~~~irC~~CG~   27 (44)
T smart00659        3 YICGECGRENEIKSKDVVRCRECGY   27 (44)
T ss_pred             EECCCCCCEeecCCCCceECCCCCc
Confidence            4788888888875   47786 654


No 41 
>PRK08402 replication factor A; Reviewed
Probab=42.60  E-value=12  Score=34.30  Aligned_cols=28  Identities=32%  Similarity=0.576  Sum_probs=19.0

Q ss_pred             Cccccccccccc----cceeee-cCccccccCCC
Q 030404          117 NRCSGCRRKVGL----TGFRCR-CGELFCGEHRY  145 (178)
Q Consensus       117 ~rC~~C~kkvgl----~gf~Cr-Cg~~FC~~HRy  145 (178)
                      .+|..|+|||-.    -.+.|. ||.+-+ .|||
T Consensus       213 ~aCp~CnKkv~~~~~~~~~~Ce~~~~v~p-~~ry  245 (355)
T PRK08402        213 DACPECRRKVDYDPATDTWICPEHGEVEP-IKIT  245 (355)
T ss_pred             ecCCCCCeEEEEecCCCCEeCCCCCCcCc-ceeE
Confidence            699999999963    247776 654433 4554


No 42 
>PHA00626 hypothetical protein
Probab=42.39  E-value=13  Score=26.11  Aligned_cols=23  Identities=17%  Similarity=0.235  Sum_probs=14.8

Q ss_pred             Cccccccccccccceeee-cCccccc
Q 030404          117 NRCSGCRRKVGLTGFRCR-CGELFCG  141 (178)
Q Consensus       117 ~rC~~C~kkvgl~gf~Cr-Cg~~FC~  141 (178)
                      .||.+|++..  .-|+|. ||+.|-.
T Consensus        12 vrcg~cr~~s--nrYkCkdCGY~ft~   35 (59)
T PHA00626         12 AKEKTMRGWS--DDYVCCDCGYNDSK   35 (59)
T ss_pred             eeeceecccC--cceEcCCCCCeech
Confidence            4777777522  238886 8877753


No 43 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=41.24  E-value=12  Score=22.92  Aligned_cols=19  Identities=42%  Similarity=1.039  Sum_probs=10.4

Q ss_pred             cccccccccccc---ceeee-cC
Q 030404          118 RCSGCRRKVGLT---GFRCR-CG  136 (178)
Q Consensus       118 rC~~C~kkvgl~---gf~Cr-Cg  136 (178)
                      .|..|+..+.|.   ..+|+ ||
T Consensus         2 ~C~~Cg~~~~~~~~~~irC~~CG   24 (32)
T PF03604_consen    2 ICGECGAEVELKPGDPIRCPECG   24 (32)
T ss_dssp             BESSSSSSE-BSTSSTSSBSSSS
T ss_pred             CCCcCCCeeEcCCCCcEECCcCC
Confidence            356666666663   35666 54


No 44 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=40.19  E-value=16  Score=27.06  Aligned_cols=15  Identities=13%  Similarity=0.373  Sum_probs=12.7

Q ss_pred             cCCcccccccccccc
Q 030404          115 VVNRCSGCRRKVGLT  129 (178)
Q Consensus       115 ~~~rC~~C~kkvgl~  129 (178)
                      .+++|..|++++...
T Consensus        32 ~rS~C~~C~~~L~~~   46 (92)
T PF06750_consen   32 PRSHCPHCGHPLSWW   46 (92)
T ss_pred             CCCcCcCCCCcCccc
Confidence            468999999999864


No 45 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=39.97  E-value=13  Score=29.38  Aligned_cols=32  Identities=38%  Similarity=0.795  Sum_probs=23.2

Q ss_pred             cCCccccccccccccc---eeee-cCccc-cccCCCC
Q 030404          115 VVNRCSGCRRKVGLTG---FRCR-CGELF-CGEHRYS  146 (178)
Q Consensus       115 ~~~rC~~C~kkvgl~g---f~Cr-Cg~~F-C~~HRy~  146 (178)
                      .=..|..|+|||-..+   |.|. |+..+ =-.+||-
T Consensus        33 ~Y~aC~~C~kkv~~~~~~~~~C~~C~~~~~~~~~ry~   69 (166)
T cd04476          33 WYPACPGCNKKVVEEGNGTYRCEKCNKSVPNPEYRYI   69 (166)
T ss_pred             EEccccccCcccEeCCCCcEECCCCCCcCCCccEEEE
Confidence            3467889999997653   8886 87765 4566774


No 46 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=39.66  E-value=10  Score=27.01  Aligned_cols=12  Identities=33%  Similarity=0.861  Sum_probs=10.4

Q ss_pred             CCcccccccccc
Q 030404          116 VNRCSGCRRKVG  127 (178)
Q Consensus       116 ~~rC~~C~kkvg  127 (178)
                      |-||++|+|-+|
T Consensus         4 PiRCFsCGkvi~   15 (63)
T COG1644           4 PVRCFSCGKVIG   15 (63)
T ss_pred             ceEeecCCCCHH
Confidence            679999999875


No 47 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=39.65  E-value=12  Score=25.41  Aligned_cols=34  Identities=29%  Similarity=0.810  Sum_probs=14.9

Q ss_pred             ccccccccccc--------ceeee-cCcccccc---CCCCCCCCCC
Q 030404          119 CSGCRRKVGLT--------GFRCR-CGELFCGE---HRYSDRHDCS  152 (178)
Q Consensus       119 C~~C~kkvgl~--------gf~Cr-Cg~~FC~~---HRy~e~H~C~  152 (178)
                      |+.|.+.+.-.        .|.|. |+..||..   -=+-.-|+|+
T Consensus         2 CfgC~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fiHE~LH~CP   47 (51)
T PF07975_consen    2 CFGCQKPFPDGPEKKADSSRYRCPKCKNHFCIDCDVFIHETLHNCP   47 (51)
T ss_dssp             ETTTTEE-TTS-------EEE--TTTT--B-HHHHHTTTTTS-SSS
T ss_pred             CccCCCCCCCcccccccCCeEECCCCCCccccCcChhhhccccCCc
Confidence            56666666553        48894 99999853   2222356654


No 48 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=39.62  E-value=21  Score=27.22  Aligned_cols=32  Identities=22%  Similarity=0.555  Sum_probs=24.8

Q ss_pred             cCCcccccccccccc---ceeee-cCccccccCCCC
Q 030404          115 VVNRCSGCRRKVGLT---GFRCR-CGELFCGEHRYS  146 (178)
Q Consensus       115 ~~~rC~~C~kkvgl~---gf~Cr-Cg~~FC~~HRy~  146 (178)
                      ....|..|.+.+|++   |..|. |...+|..=+.-
T Consensus        53 ~~~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~~~   88 (118)
T PF02318_consen   53 GERHCARCGKPFGFLFNRGRVCVDCKHRVCKKCGVY   88 (118)
T ss_dssp             CCSB-TTTS-BCSCTSTTCEEETTTTEEEETTSEEE
T ss_pred             CCcchhhhCCcccccCCCCCcCCcCCccccCccCCc
Confidence            467999999999986   68998 999999876654


No 49 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=39.57  E-value=18  Score=23.08  Aligned_cols=28  Identities=39%  Similarity=0.853  Sum_probs=19.0

Q ss_pred             Ccccccccccccc----ceeee-cCccccccCC
Q 030404          117 NRCSGCRRKVGLT----GFRCR-CGELFCGEHR  144 (178)
Q Consensus       117 ~rC~~C~kkvgl~----gf~Cr-Cg~~FC~~HR  144 (178)
                      .+|..|+..+-+.    .++|. ||..+--.+|
T Consensus         4 y~C~~CG~~~~~~~~~~~~~Cp~CG~~~~~~~~   36 (46)
T PRK00398          4 YKCARCGREVELDEYGTGVRCPYCGYRILFKER   36 (46)
T ss_pred             EECCCCCCEEEECCCCCceECCCCCCeEEEccC
Confidence            5788888887552    48886 7766554444


No 50 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=39.03  E-value=17  Score=20.55  Aligned_cols=20  Identities=25%  Similarity=0.708  Sum_probs=11.3

Q ss_pred             ccccccccccccceeee-cCc
Q 030404          118 RCSGCRRKVGLTGFRCR-CGE  137 (178)
Q Consensus       118 rC~~C~kkvgl~gf~Cr-Cg~  137 (178)
                      +|..|++++.-..-.|. ||.
T Consensus         1 ~Cp~CG~~~~~~~~fC~~CG~   21 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCPNCGT   21 (23)
T ss_pred             CCcccCCCCCCcCcchhhhCC
Confidence            36666666655544454 553


No 51 
>PF02928 zf-C5HC2:  C5HC2 zinc finger;  InterPro: IPR004198 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a predicted zinc finger with eight potential zinc ligand binding residues. This domain is found in Jumonji [], and may have a DNA binding function. The mouse jumonji protein is required for neural tube formation, and is essential for normal heart development. It also plays a role in the down-regulation of cell proliferation signalling. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005634 nucleus
Probab=38.75  E-value=15  Score=24.47  Aligned_cols=26  Identities=31%  Similarity=0.788  Sum_probs=22.1

Q ss_pred             cccccccccccceeeec--CccccccCC
Q 030404          119 CSGCRRKVGLTGFRCRC--GELFCGEHR  144 (178)
Q Consensus       119 C~~C~kkvgl~gf~CrC--g~~FC~~HR  144 (178)
                      |..|+.-.=|..+.|.|  +.++|=.|-
T Consensus         1 C~~Ck~~~yLS~v~C~C~~~~~~CL~H~   28 (54)
T PF02928_consen    1 CSICKAYCYLSAVTCSCKPDKVVCLRHA   28 (54)
T ss_pred             CcccCCchhhcccccCCCCCcEEccccc
Confidence            67788888888999997  899998884


No 52 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=37.20  E-value=20  Score=27.09  Aligned_cols=35  Identities=34%  Similarity=0.751  Sum_probs=25.7

Q ss_pred             ccccCCccccccccccc---cc-eeee-cCccccccCCCC
Q 030404          112 EKRVVNRCSGCRRKVGL---TG-FRCR-CGELFCGEHRYS  146 (178)
Q Consensus       112 ~~~~~~rC~~C~kkvgl---~g-f~Cr-Cg~~FC~~HRy~  146 (178)
                      .+..+-.|..|+++.-.   +| ..|+ ||.+|=+---.|
T Consensus        31 ~~~~~~~Cp~C~~~~VkR~a~GIW~C~kCg~~fAGgay~P   70 (89)
T COG1997          31 QQRAKHVCPFCGRTTVKRIATGIWKCRKCGAKFAGGAYTP   70 (89)
T ss_pred             HHhcCCcCCCCCCcceeeeccCeEEcCCCCCeeccccccc
Confidence            35578899999987322   23 8998 999998776665


No 53 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=35.92  E-value=24  Score=22.92  Aligned_cols=17  Identities=29%  Similarity=0.776  Sum_probs=14.7

Q ss_pred             ceee-ecCccccccCCCC
Q 030404          130 GFRC-RCGELFCGEHRYS  146 (178)
Q Consensus       130 gf~C-rCg~~FC~~HRy~  146 (178)
                      ...| .||..||..++.+
T Consensus        40 ~v~C~~C~~~fC~~C~~~   57 (64)
T smart00647       40 RVTCPKCGFSFCFRCKVP   57 (64)
T ss_pred             eeECCCCCCeECCCCCCc
Confidence            4899 8999999998865


No 54 
>PF15549 PGC7_Stella:  PGC7/Stella/Dppa3 domain 
Probab=35.79  E-value=19  Score=29.80  Aligned_cols=18  Identities=39%  Similarity=1.147  Sum_probs=15.2

Q ss_pred             eeeecCccccccCCCCCCCC
Q 030404          131 FRCRCGELFCGEHRYSDRHD  150 (178)
Q Consensus       131 f~CrCg~~FC~~HRy~e~H~  150 (178)
                      |+|.|  .||-.||.|.+-+
T Consensus       124 FrC~C--~yC~~~~~~~~~n  141 (160)
T PF15549_consen  124 FRCEC--HYCQSHRNPGERN  141 (160)
T ss_pred             eeeee--eeecccCCCcccc
Confidence            89998  7999999776665


No 55 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=35.78  E-value=13  Score=26.25  Aligned_cols=20  Identities=45%  Similarity=1.311  Sum_probs=12.2

Q ss_pred             CCccccccccccccceee-ecCc
Q 030404          116 VNRCSGCRRKVGLTGFRC-RCGE  137 (178)
Q Consensus       116 ~~rC~~C~kkvgl~gf~C-rCg~  137 (178)
                      -.||..||| +|. .|+| .||.
T Consensus        38 I~Rc~~CRk-~g~-~Y~Cp~CGF   58 (61)
T COG2888          38 IYRCAKCRK-LGN-PYRCPKCGF   58 (61)
T ss_pred             eehhhhHHH-cCC-ceECCCcCc
Confidence            467777774 333 3777 5764


No 56 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=35.39  E-value=19  Score=24.32  Aligned_cols=23  Identities=26%  Similarity=0.658  Sum_probs=19.9

Q ss_pred             cCCccccccccccccceeee-cCc
Q 030404          115 VVNRCSGCRRKVGLTGFRCR-CGE  137 (178)
Q Consensus       115 ~~~rC~~C~kkvgl~gf~Cr-Cg~  137 (178)
                      ...-|..|+-++....-.|| ||+
T Consensus        13 ~k~ICrkC~ARnp~~A~~CRKCg~   36 (48)
T PRK04136         13 NKKICMRCNARNPWRATKCRKCGY   36 (48)
T ss_pred             cccchhcccCCCCccccccccCCC
Confidence            46789999999999999998 875


No 57 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=34.87  E-value=18  Score=34.22  Aligned_cols=26  Identities=31%  Similarity=0.769  Sum_probs=20.2

Q ss_pred             CCcccccccccccc---ceeee-cCccccc
Q 030404          116 VNRCSGCRRKVGLT---GFRCR-CGELFCG  141 (178)
Q Consensus       116 ~~rC~~C~kkvgl~---gf~Cr-Cg~~FC~  141 (178)
                      .-+|-.|++++.-.   ||+|+ ||..+=.
T Consensus       350 ~p~Cp~Cg~~m~S~G~~g~rC~kCg~~~~~  379 (421)
T COG1571         350 NPVCPRCGGRMKSAGRNGFRCKKCGTRARE  379 (421)
T ss_pred             CCCCCccCCchhhcCCCCcccccccccCCc
Confidence            35999999988653   79998 9876643


No 58 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=34.46  E-value=24  Score=22.36  Aligned_cols=20  Identities=30%  Similarity=0.677  Sum_probs=16.2

Q ss_pred             ccceeee-cCccccccCCCCC
Q 030404          128 LTGFRCR-CGELFCGEHRYSD  147 (178)
Q Consensus       128 l~gf~Cr-Cg~~FC~~HRy~e  147 (178)
                      +-.|+|. ||..|=-.+.+.+
T Consensus         3 ~Yey~C~~Cg~~fe~~~~~~~   23 (42)
T PF09723_consen    3 IYEYRCEECGHEFEVLQSISE   23 (42)
T ss_pred             CEEEEeCCCCCEEEEEEEcCC
Confidence            4569997 9999988887776


No 59 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=33.76  E-value=31  Score=20.90  Aligned_cols=26  Identities=35%  Similarity=0.791  Sum_probs=18.4

Q ss_pred             cccccccccc-c-cceeee-cCccccccC
Q 030404          118 RCSGCRRKVG-L-TGFRCR-CGELFCGEH  143 (178)
Q Consensus       118 rC~~C~kkvg-l-~gf~Cr-Cg~~FC~~H  143 (178)
                      ||..|.++-- - +-|.|. |+..+|..|
T Consensus         2 rC~vC~~~k~rk~T~~~C~~C~v~lC~~~   30 (32)
T PF13842_consen    2 RCKVCSKKKRRKDTRYMCSKCDVPLCVEP   30 (32)
T ss_pred             CCeECCcCCccceeEEEccCCCCcccCCC
Confidence            6777776432 2 679997 988888776


No 60 
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=33.30  E-value=11  Score=36.20  Aligned_cols=26  Identities=42%  Similarity=1.083  Sum_probs=22.6

Q ss_pred             CCcccccccccccc--ceeee-cCccccc
Q 030404          116 VNRCSGCRRKVGLT--GFRCR-CGELFCG  141 (178)
Q Consensus       116 ~~rC~~C~kkvgl~--gf~Cr-Cg~~FC~  141 (178)
                      ..-|..|.++.||+  --.|| ||.+.|.
T Consensus       180 V~~CP~Ca~~F~l~rRrHHCRLCG~VmC~  208 (505)
T KOG1842|consen  180 VQFCPECANSFGLTRRRHHCRLCGRVMCR  208 (505)
T ss_pred             ccccccccchhhhHHHhhhhhhcchHHHH
Confidence            35799999999997  58999 9999884


No 61 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=31.97  E-value=17  Score=21.89  Aligned_cols=23  Identities=35%  Similarity=0.977  Sum_probs=15.3

Q ss_pred             Cccccccccccccceeee-cCcccccc
Q 030404          117 NRCSGCRRKVGLTGFRCR-CGELFCGE  142 (178)
Q Consensus       117 ~rC~~C~kkvgl~gf~Cr-Cg~~FC~~  142 (178)
                      ..|..|+.   ..-++|. |+..||+.
T Consensus         3 ~~C~vC~~---~~kY~Cp~C~~~~CSl   26 (30)
T PF04438_consen    3 KLCSVCGN---PAKYRCPRCGARYCSL   26 (30)
T ss_dssp             EEETSSSS---EESEE-TTT--EESSH
T ss_pred             CCCccCcC---CCEEECCCcCCceeCc
Confidence            46888887   4568994 99999985


No 62 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=31.95  E-value=27  Score=19.95  Aligned_cols=21  Identities=24%  Similarity=0.661  Sum_probs=13.1

Q ss_pred             Cccccccccccccceeee-cCc
Q 030404          117 NRCSGCRRKVGLTGFRCR-CGE  137 (178)
Q Consensus       117 ~rC~~C~kkvgl~gf~Cr-Cg~  137 (178)
                      ..|..|++.+....-.|. ||.
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCcccccChhhCC
Confidence            467778776655555665 554


No 63 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=31.55  E-value=20  Score=23.26  Aligned_cols=16  Identities=31%  Similarity=0.742  Sum_probs=14.0

Q ss_pred             eeee-cCccccccCCCC
Q 030404          131 FRCR-CGELFCGEHRYS  146 (178)
Q Consensus       131 f~Cr-Cg~~FC~~HRy~  146 (178)
                      +.|. |+..||..++-+
T Consensus        41 ~~C~~C~~~fC~~C~~~   57 (64)
T PF01485_consen   41 VTCPSCGTEFCFKCGEP   57 (64)
T ss_dssp             CCTTSCCSEECSSSTSE
T ss_pred             eECCCCCCcCccccCcc
Confidence            7898 999999998864


No 64 
>PRK07218 replication factor A; Provisional
Probab=30.56  E-value=23  Score=33.28  Aligned_cols=21  Identities=33%  Similarity=0.839  Sum_probs=16.1

Q ss_pred             CCccccccccccccceeee-cCcc
Q 030404          116 VNRCSGCRRKVGLTGFRCR-CGEL  138 (178)
Q Consensus       116 ~~rC~~C~kkvgl~gf~Cr-Cg~~  138 (178)
                      -.||..|+|+|..  +.|+ ||.+
T Consensus       297 i~rCP~C~r~v~~--~~C~~hG~v  318 (423)
T PRK07218        297 IERCPECGRVIQK--GQCRSHGAV  318 (423)
T ss_pred             eecCcCccccccC--CcCCCCCCc
Confidence            3799999999954  6787 6644


No 65 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=29.48  E-value=37  Score=24.14  Aligned_cols=24  Identities=29%  Similarity=0.708  Sum_probs=16.8

Q ss_pred             CCccccccccccccceeee-cCccc
Q 030404          116 VNRCSGCRRKVGLTGFRCR-CGELF  139 (178)
Q Consensus       116 ~~rC~~C~kkvgl~gf~Cr-Cg~~F  139 (178)
                      ...|..|+|++|..-|.=- ||.+|
T Consensus        78 ~~~C~vC~k~l~~~~f~~~p~~~v~  102 (109)
T PF10367_consen   78 STKCSVCGKPLGNSVFVVFPCGHVV  102 (109)
T ss_pred             CCCccCcCCcCCCceEEEeCCCeEE
Confidence            4789999999998654332 55544


No 66 
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=29.33  E-value=25  Score=24.89  Aligned_cols=23  Identities=35%  Similarity=0.882  Sum_probs=18.1

Q ss_pred             cCCcccccccccccc---ceeee-cCc
Q 030404          115 VVNRCSGCRRKVGLT---GFRCR-CGE  137 (178)
Q Consensus       115 ~~~rC~~C~kkvgl~---gf~Cr-Cg~  137 (178)
                      -..-|.-|+-+.-|.   .+.|| ||+
T Consensus        19 miYiCgdC~~en~lk~~D~irCReCG~   45 (62)
T KOG3507|consen   19 MIYICGDCGQENTLKRGDVIRCRECGY   45 (62)
T ss_pred             EEEEeccccccccccCCCcEehhhcch
Confidence            357899999988884   39999 864


No 67 
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]
Probab=29.01  E-value=20  Score=35.67  Aligned_cols=50  Identities=32%  Similarity=0.697  Sum_probs=31.9

Q ss_pred             Cccccccccccccceeee-cCccc---cccCCCCCCCCCCccchHhhHHHHHHhCCccc
Q 030404          117 NRCSGCRRKVGLTGFRCR-CGELF---CGEHRYSDRHDCSYDYKSAGRDAIARENPVIK  171 (178)
Q Consensus       117 ~rC~~C~kkvgl~gf~Cr-Cg~~F---C~~HRy~e~H~C~fDyk~~~r~~l~k~NP~v~  171 (178)
                      --|..|.+++=.+||+|+ ||+.|   |+.| -|.  .|. +|. -.|+.+...+|-+.
T Consensus       190 ~fC~~~~~~~l~~gfrC~~C~~KfHq~Cs~~-vp~--~C~-~~~-~~~~~~~~~~~~~~  243 (678)
T KOG0193|consen  190 AFCDSCCNKFLFTGFRCQTCGYKFHQSCSPR-VPT--SCV-NPD-HLRQLLVFEFPAVG  243 (678)
T ss_pred             hhhhhhcchhhhcccccCCCCCccccccCCC-CCC--CCC-Ccc-hHhhhhhhcccccc
Confidence            457777788878999999 99876   4443 222  343 332 34566666666553


No 68 
>PHA00616 hypothetical protein
Probab=27.85  E-value=16  Score=24.10  Aligned_cols=11  Identities=45%  Similarity=1.410  Sum_probs=7.9

Q ss_pred             eee-ecCccccc
Q 030404          131 FRC-RCGELFCG  141 (178)
Q Consensus       131 f~C-rCg~~FC~  141 (178)
                      |+| |||.+|..
T Consensus         2 YqC~~CG~~F~~   13 (44)
T PHA00616          2 YQCLRCGGIFRK   13 (44)
T ss_pred             CccchhhHHHhh
Confidence            567 58888864


No 69 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=27.62  E-value=26  Score=18.59  Aligned_cols=9  Identities=44%  Similarity=1.575  Sum_probs=4.9

Q ss_pred             eeee-cCccc
Q 030404          131 FRCR-CGELF  139 (178)
Q Consensus       131 f~Cr-Cg~~F  139 (178)
                      |.|. ||..|
T Consensus         1 y~C~~C~~~f   10 (23)
T PF00096_consen    1 YKCPICGKSF   10 (23)
T ss_dssp             EEETTTTEEE
T ss_pred             CCCCCCCCcc
Confidence            4554 65555


No 70 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=26.73  E-value=30  Score=22.10  Aligned_cols=28  Identities=21%  Similarity=0.549  Sum_probs=19.6

Q ss_pred             CCccccccccccccceeeecCccccccC
Q 030404          116 VNRCSGCRRKVGLTGFRCRCGELFCGEH  143 (178)
Q Consensus       116 ~~rC~~C~kkvgl~gf~CrCg~~FC~~H  143 (178)
                      =-+|..|++.|...+|.=+=|..||..|
T Consensus        26 Cf~C~~C~~~l~~~~~~~~~~~~~C~~c   53 (58)
T PF00412_consen   26 CFKCSKCGKPLNDGDFYEKDGKPYCKDC   53 (58)
T ss_dssp             TSBETTTTCBTTTSSEEEETTEEEEHHH
T ss_pred             ccccCCCCCccCCCeeEeECCEEECHHH
Confidence            3678888888877766656666666554


No 71 
>PF08073 CHDNT:  CHDNT (NUC034) domain;  InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [].; GO: 0003677 DNA binding, 0005524 ATP binding, 0008270 zinc ion binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=26.68  E-value=23  Score=24.48  Aligned_cols=20  Identities=25%  Similarity=0.386  Sum_probs=16.5

Q ss_pred             HhhHHHHHHhCCcccccccc
Q 030404          157 SAGRDAIARENPVIKAAKIV  176 (178)
Q Consensus       157 ~~~r~~l~k~NP~v~~~Kl~  176 (178)
                      ..=|-.|+++||++.-.||-
T Consensus        21 q~vRP~l~~~NPk~~~sKl~   40 (55)
T PF08073_consen   21 QHVRPLLAKANPKAPMSKLM   40 (55)
T ss_pred             HHHHHHHHHHCCCCcHHHHH
Confidence            34588899999999888874


No 72 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=26.64  E-value=23  Score=22.18  Aligned_cols=29  Identities=24%  Similarity=0.503  Sum_probs=19.4

Q ss_pred             ccccccccccc--cceeeecCccccccCCCC
Q 030404          118 RCSGCRRKVGL--TGFRCRCGELFCGEHRYS  146 (178)
Q Consensus       118 rC~~C~kkvgl--~gf~CrCg~~FC~~HRy~  146 (178)
                      +|..|.++...  ..+.=.||.+||..+-..
T Consensus         1 ~C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~   31 (44)
T PF14634_consen    1 HCNICFEKYSEERRPRLTSCGHIFCEKCLKK   31 (44)
T ss_pred             CCcCcCccccCCCCeEEcccCCHHHHHHHHh
Confidence            47778877722  234456999999876543


No 73 
>PRK12366 replication factor A; Reviewed
Probab=25.83  E-value=29  Score=33.99  Aligned_cols=29  Identities=28%  Similarity=0.732  Sum_probs=21.0

Q ss_pred             CCcccccccccccc--ceeee-cCccccccCCC
Q 030404          116 VNRCSGCRRKVGLT--GFRCR-CGELFCGEHRY  145 (178)
Q Consensus       116 ~~rC~~C~kkvgl~--gf~Cr-Cg~~FC~~HRy  145 (178)
                      -.+|..|+|||-..  .|.|. ||.+ =..|||
T Consensus       532 y~aCp~CnkKv~~~~g~~~C~~c~~~-~p~~~~  563 (637)
T PRK12366        532 LYLCPNCRKRVEEVDGEYICEFCGEV-EPNELL  563 (637)
T ss_pred             EecccccCeEeEcCCCcEECCCCCCC-CCcEEE
Confidence            37999999999653  28895 8877 335665


No 74 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=25.83  E-value=29  Score=26.18  Aligned_cols=33  Identities=27%  Similarity=0.765  Sum_probs=22.9

Q ss_pred             cccCCccccccccccc----cc-eeee-cCccccccCCCC
Q 030404          113 KRVVNRCSGCRRKVGL----TG-FRCR-CGELFCGEHRYS  146 (178)
Q Consensus       113 ~~~~~rC~~C~kkvgl----~g-f~Cr-Cg~~FC~~HRy~  146 (178)
                      +.....|..|++.. +    +| .+|+ ||.+|-+-=-.|
T Consensus        32 q~~ky~Cp~Cgk~~-vkR~a~GIW~C~~C~~~~AGGAy~~   70 (90)
T PF01780_consen   32 QHAKYTCPFCGKTS-VKRVATGIWKCKKCGKKFAGGAYTP   70 (90)
T ss_dssp             HHS-BEESSSSSSE-EEEEETTEEEETTTTEEEE-BSSSS
T ss_pred             HhCCCcCCCCCCce-eEEeeeEEeecCCCCCEEeCCCccc
Confidence            44678999999865 3    13 8998 999998765443


No 75 
>PF08600 Rsm1:  Rsm1-like;  InterPro: IPR013909 This entry contains Nuclear-interacting partner of ALK (NIPA) and NIPA like proteins, as well as mRNA export factor Rsm1, all of which contain a C3HC-type zinc finger. The domain represented in this entry is found C-terminal to the zinc-finger like domain IPR012935 from INTERPRO. Rsm1 is involved in mRNA export from the nucleus []. NIPA is an essential component of an SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry [].
Probab=25.67  E-value=26  Score=25.78  Aligned_cols=18  Identities=39%  Similarity=0.726  Sum_probs=14.8

Q ss_pred             CCccccccccccccceee
Q 030404          116 VNRCSGCRRKVGLTGFRC  133 (178)
Q Consensus       116 ~~rC~~C~kkvgl~gf~C  133 (178)
                      .-.|..|.+||||=.|+=
T Consensus        19 ~~~C~~C~Rr~GLW~f~~   36 (91)
T PF08600_consen   19 LLSCSYCFRRLGLWMFKS   36 (91)
T ss_pred             eEEccccCcEeeeeeccc
Confidence            468999999999976654


No 76 
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=24.63  E-value=32  Score=35.41  Aligned_cols=45  Identities=27%  Similarity=0.659  Sum_probs=30.8

Q ss_pred             ccccCCccccccccc--------------cccceeee-cCccccc---------cCCCC----CCCCCCccch
Q 030404          112 EKRVVNRCSGCRRKV--------------GLTGFRCR-CGELFCG---------EHRYS----DRHDCSYDYK  156 (178)
Q Consensus       112 ~~~~~~rC~~C~kkv--------------gl~gf~Cr-Cg~~FC~---------~HRy~----e~H~C~fDyk  156 (178)
                      +...+|.|..|.|-|              |-..|+|+ ||.-|--         .||-.    -.|.|.+-|-
T Consensus       601 ~~TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~i  673 (958)
T KOG1074|consen  601 KRTDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFI  673 (958)
T ss_pred             ccCCccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhh
Confidence            345789999998744              33359999 9999963         34432    5677875543


No 77 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=23.52  E-value=38  Score=20.39  Aligned_cols=12  Identities=42%  Similarity=1.115  Sum_probs=6.9

Q ss_pred             cceeee-cCcccc
Q 030404          129 TGFRCR-CGELFC  140 (178)
Q Consensus       129 ~gf~Cr-Cg~~FC  140 (178)
                      -.|+|. ||..|=
T Consensus         4 Y~y~C~~Cg~~fe   16 (41)
T smart00834        4 YEYRCEDCGHTFE   16 (41)
T ss_pred             EEEEcCCCCCEEE
Confidence            346665 666554


No 78 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=23.00  E-value=46  Score=23.81  Aligned_cols=27  Identities=26%  Similarity=0.498  Sum_probs=11.3

Q ss_pred             CCccccccccccccceeeecCcccccc
Q 030404          116 VNRCSGCRRKVGLTGFRCRCGELFCGE  142 (178)
Q Consensus       116 ~~rC~~C~kkvgl~gf~CrCg~~FC~~  142 (178)
                      --||..|.--+...--.=.|+++||+.
T Consensus         7 lLrCs~C~~~l~~pv~l~~CeH~fCs~   33 (65)
T PF14835_consen    7 LLRCSICFDILKEPVCLGGCEHIFCSS   33 (65)
T ss_dssp             TTS-SSS-S--SS-B---SSS--B-TT
T ss_pred             hcCCcHHHHHhcCCceeccCccHHHHH
Confidence            468898887654433334689999985


No 79 
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway. Domain is involved in recognition of N-end rule substrates in yeast Ubr1p
Probab=21.67  E-value=50  Score=23.24  Aligned_cols=13  Identities=38%  Similarity=0.907  Sum_probs=11.4

Q ss_pred             eeeecCcc-------ccccC
Q 030404          131 FRCRCGEL-------FCGEH  143 (178)
Q Consensus       131 f~CrCg~~-------FC~~H  143 (178)
                      |.|-||..       ||..|
T Consensus        51 ~~CDCG~~~~~~~~~~C~~h   70 (71)
T smart00396       51 GICDCGDKEAWNEDLKCKAH   70 (71)
T ss_pred             EEECCCChhccCCCcccccc
Confidence            89999988       88887


No 80 
>smart00508 PostSET Cysteine-rich motif following a subset of SET domains.
Probab=21.08  E-value=50  Score=19.54  Aligned_cols=11  Identities=36%  Similarity=0.878  Sum_probs=9.8

Q ss_pred             eeeecCccccc
Q 030404          131 FRCRCGELFCG  141 (178)
Q Consensus       131 f~CrCg~~FC~  141 (178)
                      |.|+||...|-
T Consensus         3 ~~C~CGs~~CR   13 (26)
T smart00508        3 QPCLCGAPNCR   13 (26)
T ss_pred             eeeeCCCcccc
Confidence            78999999886


No 81 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=20.91  E-value=35  Score=26.11  Aligned_cols=18  Identities=28%  Similarity=0.661  Sum_probs=11.5

Q ss_pred             ccccccceeee-cCccccc
Q 030404          124 RKVGLTGFRCR-CGELFCG  141 (178)
Q Consensus       124 kkvgl~gf~Cr-Cg~~FC~  141 (178)
                      ++|=+..-.|| ||++|=.
T Consensus        52 ~~Llv~Pa~CkkCGfef~~   70 (97)
T COG3357          52 KRLLVRPARCKKCGFEFRD   70 (97)
T ss_pred             ceEEecChhhcccCccccc
Confidence            34444467887 8888754


No 82 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=20.74  E-value=50  Score=25.98  Aligned_cols=11  Identities=27%  Similarity=0.863  Sum_probs=9.1

Q ss_pred             CCccccccccc
Q 030404          116 VNRCSGCRRKV  126 (178)
Q Consensus       116 ~~rC~~C~kkv  126 (178)
                      -.||..||..+
T Consensus        91 ~sRC~~CN~~L  101 (147)
T PF01927_consen   91 FSRCPKCNGPL  101 (147)
T ss_pred             CCccCCCCcEe
Confidence            58999999766


No 83 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=20.38  E-value=56  Score=18.42  Aligned_cols=10  Identities=40%  Similarity=1.364  Sum_probs=5.4

Q ss_pred             ceeee-cCccc
Q 030404          130 GFRCR-CGELF  139 (178)
Q Consensus       130 gf~Cr-Cg~~F  139 (178)
                      .|.|. |+..|
T Consensus        14 ~~~C~~C~k~F   24 (26)
T PF13465_consen   14 PYKCPYCGKSF   24 (26)
T ss_dssp             SEEESSSSEEE
T ss_pred             CCCCCCCcCee
Confidence            36665 55554


No 84 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=20.37  E-value=67  Score=21.63  Aligned_cols=24  Identities=25%  Similarity=0.636  Sum_probs=17.2

Q ss_pred             cCCccccccccccc--c--ceeee-cCcc
Q 030404          115 VVNRCSGCRRKVGL--T--GFRCR-CGEL  138 (178)
Q Consensus       115 ~~~rC~~C~kkvgl--~--gf~Cr-Cg~~  138 (178)
                      ....|..|+.++.-  .  .|.|. ||..
T Consensus        27 TSq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   27 TSQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             CccCccCcccccccccccceEEcCCCCCE
Confidence            45679999988776  2  48887 7665


No 85 
>PRK08197 threonine synthase; Validated
Probab=20.35  E-value=46  Score=30.12  Aligned_cols=31  Identities=19%  Similarity=0.399  Sum_probs=23.7

Q ss_pred             CCccccccccccccc--eeeecCccccccCCCC
Q 030404          116 VNRCSGCRRKVGLTG--FRCRCGELFCGEHRYS  146 (178)
Q Consensus       116 ~~rC~~C~kkvgl~g--f~CrCg~~FC~~HRy~  146 (178)
                      .-+|..|++...+..  +.|+||..+=-.+.|+
T Consensus         7 ~~~C~~Cg~~~~~~~~~~~C~cg~~l~~~~d~~   39 (394)
T PRK08197          7 HLECSKCGETYDADQVHNLCKCGKPLLVRYDLE   39 (394)
T ss_pred             EEEECCCCCCCCCCCcceecCCCCeeEEEechh
Confidence            469999999998864  6899987765555543


Done!