Citrus Sinensis ID: 030407

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18

MLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS

cHHHHHHHHccccEEEEEcccccHHHHHHHHHccccccccEEEECccccccccccccccccHHHHHHHHccccccEEEEEcccccCECccccccccEEEEEEEccccccccccccccccECcEEEEEcccccccccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHc

MLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLALCKFLRDKYSLAAVTNDIFTKEDGEFLMRNGALPEERIRAVETGGCPHAAIREDISINLGPLEELSNLFKADLLLCESGGDNLAANFSRELADYIIYIIDVSGGDKIPRKGGPGITQADLLVINKTDLASAIGADLAVMERDALRMRDGGPFIFAQVGWVIGIIFTLSITHYIVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Urease accessory protein UreG	Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG.	probable	B0V9P2
Urease accessory protein UreG	Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG.	probable	A3M3F5
Urease accessory protein UreG	Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG.	probable	Q7V3V8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HF9, chain A
Confidence level:very confident
Coverage over the Query: 2-176
View the alignment between query and template
View the model in PyMOL