Query         030408
Match_columns 178
No_of_seqs    140 out of 678
Neff          5.0 
Searched_HMMs 46136
Date          Fri Mar 29 13:17:02 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030408.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030408hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02629 powdery mildew resist 100.0 2.6E-54 5.6E-59  388.2  13.9  133   41-177    47-182 (387)
  2 PF14416 PMR5N:  PMR5 N termina  99.9 1.5E-26 3.2E-31  157.7   4.6   54   44-101     1-55  (55)
  3 PF13839 PC-Esterase:  GDSL/SGN  99.7 1.1E-17 2.3E-22  137.7   7.4   75  102-176     1-81  (263)
  4 cd01842 SGNH_hydrolase_like_5   88.7    0.34 7.4E-06   40.6   2.5   23  119-141     2-24  (183)
  5 COG2845 Uncharacterized protei  85.7    0.88 1.9E-05   41.5   3.5   30  111-140   111-140 (354)
  6 cd01829 SGNH_hydrolase_peri2 S  84.8    0.83 1.8E-05   36.0   2.7   22  118-139     1-22  (200)
  7 cd01834 SGNH_hydrolase_like_2   84.4    0.51 1.1E-05   36.3   1.3   15  116-130     1-15  (191)
  8 cd01841 NnaC_like NnaC (CMP-Ne  82.7    0.63 1.4E-05   35.9   1.2   17  117-133     1-17  (174)
  9 cd01825 SGNH_hydrolase_peri1 S  72.7     1.6 3.5E-05   33.7   0.8   18  118-135     1-19  (189)
 10 cd01844 SGNH_hydrolase_like_6   70.9       2 4.3E-05   33.6   1.0   13  118-130     1-13  (177)
 11 cd01838 Isoamyl_acetate_hydrol  70.9     1.9 4.1E-05   33.4   0.8   13  118-130     1-13  (199)
 12 cd01835 SGNH_hydrolase_like_3   69.5     2.1 4.5E-05   33.6   0.8   13  117-129     2-14  (193)
 13 cd01832 SGNH_hydrolase_like_1   67.7     2.3   5E-05   32.9   0.7   11  118-128     1-11  (185)
 14 PF00185 OTCace:  Aspartate/orn  67.1     4.4 9.6E-05   32.2   2.2   25  115-140     1-25  (158)
 15 cd01820 PAF_acetylesterase_lik  67.0     4.4 9.6E-05   32.7   2.3   15  116-130    32-46  (214)
 16 PRK10528 multifunctional acyl-  63.0       4 8.8E-05   32.7   1.3   15  116-130    10-24  (191)
 17 cd01827 sialate_O-acetylestera  62.5     3.9 8.4E-05   31.8   1.1   13  118-130     2-14  (188)
 18 cd01822 Lysophospholipase_L1_l  61.8       4 8.6E-05   31.2   1.0   12  118-129     2-13  (177)
 19 cd01833 XynB_like SGNH_hydrola  61.0     3.2   7E-05   31.4   0.4   12  118-129     2-13  (157)
 20 cd01831 Endoglucanase_E_like E  60.8     4.4 9.6E-05   31.4   1.1   15  118-132     1-15  (169)
 21 PF09949 DUF2183:  Uncharacteri  60.6     7.6 0.00016   29.2   2.3   24  106-129    54-77  (100)
 22 cd00229 SGNH_hydrolase SGNH_hy  58.1     3.7 8.1E-05   29.7   0.3   18  119-136     1-18  (187)
 23 PF12026 DUF3513:  Domain of un  57.2    0.65 1.4E-05   39.6  -4.4   17  114-130   132-148 (210)
 24 cd04501 SGNH_hydrolase_like_4   55.5     5.7 0.00012   30.8   0.9   12  117-128     1-12  (183)
 25 cd01836 FeeA_FeeB_like SGNH_hy  53.8     6.8 0.00015   30.6   1.1   14  117-130     3-16  (191)
 26 cd01828 sialate_O-acetylestera  53.5     6.1 0.00013   30.3   0.8   15  119-133     2-16  (169)
 27 cd01830 XynE_like SGNH_hydrola  52.6     7.3 0.00016   31.2   1.2   12  118-129     1-12  (204)
 28 cd01839 SGNH_arylesterase_like  52.5     7.4 0.00016   31.0   1.2   13  118-130     1-13  (208)
 29 PRK14805 ornithine carbamoyltr  52.3      10 0.00022   33.5   2.2   27  112-140   143-169 (302)
 30 cd01821 Rhamnogalacturan_acety  51.0     7.3 0.00016   30.8   0.9   15  118-132     2-16  (198)
 31 PRK04284 ornithine carbamoyltr  48.9      14  0.0003   33.2   2.4   27  113-140   152-178 (332)
 32 cd04502 SGNH_hydrolase_like_7   47.4     9.3  0.0002   29.4   1.0   14  119-132     2-15  (171)
 33 PRK00856 pyrB aspartate carbam  43.8      18  0.0004   32.0   2.4   28  113-140   153-180 (305)
 34 PF00702 Hydrolase:  haloacid d  43.2      20 0.00044   27.9   2.4   20  108-127   185-206 (215)
 35 PRK02102 ornithine carbamoyltr  42.1      21 0.00046   32.2   2.5   27  113-140   152-178 (331)
 36 TIGR01489 DKMTPPase-SF 2,3-dik  42.0      28 0.00062   26.6   3.0   13  116-128   162-174 (188)
 37 PLN02527 aspartate carbamoyltr  41.8      21 0.00046   31.6   2.5   27  113-139   148-174 (306)
 38 cd04506 SGNH_hydrolase_YpmR_li  41.0      14  0.0003   29.2   1.0   12  118-129     1-12  (204)
 39 PRK01713 ornithine carbamoyltr  39.4      24 0.00052   31.7   2.5   26  114-140   154-179 (334)
 40 COG0078 ArgF Ornithine carbamo  38.9      23  0.0005   32.0   2.2   21  114-136   151-171 (310)
 41 cd01840 SGNH_hydrolase_yrhL_li  38.6      24 0.00051   27.0   2.0   20  119-138     2-21  (150)
 42 COG0034 PurF Glutamine phospho  38.3      19  0.0004   34.3   1.6   32  110-141   342-374 (470)
 43 PF01861 DUF43:  Protein of unk  37.9      15 0.00033   32.0   0.9   12  114-125    43-54  (243)
 44 PLN02342 ornithine carbamoyltr  36.4      29 0.00063   31.6   2.5   26  113-140   191-216 (348)
 45 PRK08192 aspartate carbamoyltr  35.7      28 0.00062   31.3   2.3   26  114-139   157-182 (338)
 46 COG0540 PyrB Aspartate carbamo  34.1      13 0.00028   33.7  -0.1   45   96-140   138-182 (316)
 47 TIGR00670 asp_carb_tr aspartat  33.6      26 0.00056   31.0   1.7   29  112-140   146-174 (301)
 48 PRK12562 ornithine carbamoyltr  33.6      34 0.00074   30.9   2.5   26  114-140   154-179 (334)
 49 PRK11891 aspartate carbamoyltr  31.7      38 0.00082   31.8   2.5   26  114-139   239-264 (429)
 50 PF13086 AAA_11:  AAA domain; P  30.4      46   0.001   25.9   2.5   16  110-125   210-226 (236)
 51 PF04954 SIP:  Siderophore-inte  29.9 1.1E+02  0.0023   22.9   4.4   23  117-139     2-24  (119)
 52 PRK03515 ornithine carbamoyltr  29.7      43 0.00094   30.2   2.5   26  114-140   154-179 (336)
 53 PF00657 Lipase_GDSL:  GDSL-lik  29.5      28  0.0006   27.1   1.1   11  119-129     1-11  (234)
 54 PF13242 Hydrolase_like:  HAD-h  29.2      56  0.0012   22.1   2.5   21  115-135    20-40  (75)
 55 PRK00779 ornithine carbamoyltr  28.5      41  0.0009   29.7   2.1   43   96-140   132-174 (304)
 56 PRK14804 ornithine carbamoyltr  28.3      46 0.00099   29.6   2.4   26  113-140   150-175 (311)
 57 cd01823 SEST_like SEST_like. A  26.9      32  0.0007   28.2   1.1   13  117-129     1-13  (259)
 58 TIGR00658 orni_carb_tr ornithi  26.4      53  0.0011   29.0   2.4   25  114-140   146-170 (304)
 59 TIGR03333 salvage_mtnX 2-hydro  25.3      55  0.0012   26.5   2.2   14  115-128   155-168 (214)
 60 KOG0572 Glutamine phosphoribos  25.1      36 0.00078   32.2   1.1   30  112-141   352-382 (474)
 61 PF12710 HAD:  haloacid dehalog  24.9      50  0.0011   25.3   1.8   13  115-127   174-186 (192)
 62 PF14647 FAM91_N:  FAM91 N-term  24.8      81  0.0018   28.6   3.3   31  101-141   108-138 (308)
 63 PF03193 DUF258:  Protein of un  24.6      64  0.0014   26.2   2.4   35  105-141    24-58  (161)
 64 PF13289 SIR2_2:  SIR2-like dom  23.8 1.6E+02  0.0034   21.6   4.3   33  108-140    78-110 (143)
 65 PLN02954 phosphoserine phospha  23.8      67  0.0015   25.7   2.4   14  116-129   169-182 (224)
 66 CHL00073 chlN photochlorophyll  23.4      99  0.0022   29.2   3.7   27  110-139   308-334 (457)
 67 PRK02255 putrescine carbamoylt  23.4      69  0.0015   28.9   2.6   24  114-139   152-175 (338)
 68 PF13419 HAD_2:  Haloacid dehal  23.1      81  0.0017   23.1   2.6   16  115-131   149-164 (176)
 69 PRK10113 cell division modulat  22.3      44 0.00095   24.2   0.9   17  113-129    38-56  (80)
 70 PRK13814 pyrB aspartate carbam  21.9      53  0.0011   29.3   1.6   27  113-139   154-180 (310)
 71 PF09084 NMT1:  NMT1/THI5 like;  21.6      69  0.0015   25.2   2.1   26  111-136    88-113 (216)
 72 PHA02597 30.2 hypothetical pro  20.5      73  0.0016   25.0   2.0   23  106-128   132-157 (197)
 73 COG5275 BRCT domain type II [G  20.1      73  0.0016   28.0   2.0   30  111-140   154-185 (276)
 74 PRK13376 pyrB bifunctional asp  20.1      79  0.0017   30.5   2.4   26  114-139   172-197 (525)

No 1  
>PLN02629 powdery mildew resistance 5
Probab=100.00  E-value=2.6e-54  Score=388.22  Aligned_cols=133  Identities=30%  Similarity=0.671  Sum_probs=121.8

Q ss_pred             CCCCCCCccccCceeecCCCCCCCCCC-CCCc-CcccccccccCCCCCcccceeeeeeCCCCCCCCCChHHHHHHhcCCc
Q 030408           41 SFHSTPCNLFLGKWVLQHPSTHKPLYN-ETCP-FQRNAWNCLRNQRPNMVLINSYKWVPEACDLPQIDPVKFLSLMRNKN  118 (178)
Q Consensus        41 ~~~~~~Cd~~~G~WV~d~~~~~~P~Y~-~tCp-~i~~~~~C~~nGRpD~~~~~~wrWqP~gC~lp~fd~~~fl~~lrgk~  118 (178)
                      ..+.++||+|+|+||+|   .++|+|+ .+|| ||+++|||++|||||++|+ +|||||+||+|||||+.+||+.|||||
T Consensus        47 ~~~~~~CD~f~G~WV~D---~s~PlY~~~~Cp~fi~~~~nC~knGRPD~~Yl-~WRWqP~gC~LPRFda~~fLe~~RgKr  122 (387)
T PLN02629         47 QANQSTCALFVGTWVRD---DSYPLYQSSDCPGVIDPEFNCQMYGRPDSDYL-KYRWQPLNCELPRFNGLEFLLKMKGKT  122 (387)
T ss_pred             CCCccccCCCCCeEecC---CCCCCCCCCCCccccccccchhhcCCCCcchh-hccccCCCCCCCCcCHHHHHHHhcCCe
Confidence            35678899999999999   4789998 5999 9999999999999999999 699999999999999999999999999


Q ss_pred             EEEEecchhhHHHHHHHHhhhhcccCCc-eeeecCceeeEEEeeccEEEEEEecccceec
Q 030408          119 IGFVGDSLNENFIVSFLCVLRAADSGAK-KWKRKGAWRGGYFPKYNVTVAYHRAVLLANY  177 (178)
Q Consensus       119 i~FVGDSl~Rn~~~SL~clL~~~~~~~~-~~~~~~~~~~~~f~~yn~tv~f~WsPfLv~~  177 (178)
                      ||||||||+||||+||+|||++++|... .+.+++..+.|+|++||+||+||||||||+.
T Consensus       123 l~FVGDSL~RNQ~eSLvClL~~~~p~~~~~~~~~~~~~~~~F~~yN~TV~~ywspfLV~~  182 (387)
T PLN02629        123 VMFVGDSLGRNQWESLICLISSSVPSTRTQMSRGDPLSTFKFLDYGVSISFYKAPYLVDI  182 (387)
T ss_pred             EEEeccccchhHHHHHHHHhhccCCCCceeeecCCceEEEEeccCCEEEEEEecceEEee
Confidence            9999999999999999999999887543 3445566788999999999999999999985


No 2  
>PF14416 PMR5N:  PMR5 N terminal Domain
Probab=99.93  E-value=1.5e-26  Score=157.73  Aligned_cols=54  Identities=39%  Similarity=1.032  Sum_probs=49.7

Q ss_pred             CCCCccccCceeecCCCCCCCCCC-CCCcCcccccccccCCCCCcccceeeeeeCCCCC
Q 030408           44 STPCNLFLGKWVLQHPSTHKPLYN-ETCPFQRNAWNCLRNQRPNMVLINSYKWVPEACD  101 (178)
Q Consensus        44 ~~~Cd~~~G~WV~d~~~~~~P~Y~-~tCp~i~~~~~C~~nGRpD~~~~~~wrWqP~gC~  101 (178)
                      +++||+|+|+||+|   .++|+|+ ++||||+++|||++|||||++|+ +|||||++|+
T Consensus         1 e~~Cd~~~G~WV~D---~~~PlY~~~~Cp~i~~~~nC~~nGRpD~~y~-~wRWqP~~Cd   55 (55)
T PF14416_consen    1 EKRCDYFDGRWVPD---PSYPLYTNSTCPFIDEGFNCQKNGRPDSDYL-KWRWQPRGCD   55 (55)
T ss_pred             CCccCcccCEEEeC---CCCCccCCCCCCcCCCccchhhcCCCCCccc-eeeecCCCCC
Confidence            36799999999999   4679996 69999999999999999999998 5999999996


No 3  
>PF13839 PC-Esterase:  GDSL/SGNH-like Acyl-Esterase family found in Pmr5 and Cas1p
Probab=99.72  E-value=1.1e-17  Score=137.67  Aligned_cols=75  Identities=29%  Similarity=0.403  Sum_probs=61.8

Q ss_pred             CCCCChHHHHHHhcCCcEEEEecchhhHHHHHHHHhhhhccc-----CCce-eeecCceeeEEEeeccEEEEEEecccce
Q 030408          102 LPQIDPVKFLSLMRNKNIGFVGDSLNENFIVSFLCVLRAADS-----GAKK-WKRKGAWRGGYFPKYNVTVAYHRAVLLA  175 (178)
Q Consensus       102 lp~fd~~~fl~~lrgk~i~FVGDSl~Rn~~~SL~clL~~~~~-----~~~~-~~~~~~~~~~~f~~yn~tv~f~WsPfLv  175 (178)
                      +++||+.++|++||||+|+|||||++||+|+||+|+|.+..+     .... ....+....+.+.++|+||+|+|+|||+
T Consensus         1 ~~~~d~~~cL~~lr~k~i~fiGDS~~Rq~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~p~l~   80 (263)
T PF13839_consen    1 LPRFDARECLQRLRNKRIVFIGDSTTRQQYESLVCLLGPEVPSWQESPHSGIEFPNHRNFRYNFPDYNVTLSFYWDPFLV   80 (263)
T ss_pred             CChhhHHHHHHHccCCEEEEEechhhHHHHHHHHHHHhccccccccccccccccccCCceEEeecCCCeEEEEecccccc
Confidence            578999999999999999999999999999999999998665     2111 1112334567889999999999999998


Q ss_pred             e
Q 030408          176 N  176 (178)
Q Consensus       176 ~  176 (178)
                      +
T Consensus        81 ~   81 (263)
T PF13839_consen   81 D   81 (263)
T ss_pred             c
Confidence            4


No 4  
>cd01842 SGNH_hydrolase_like_5 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=88.71  E-value=0.34  Score=40.56  Aligned_cols=23  Identities=17%  Similarity=0.390  Sum_probs=21.4

Q ss_pred             EEEEecchhhHHHHHHHHhhhhc
Q 030408          119 IGFVGDSLNENFIVSFLCVLRAA  141 (178)
Q Consensus       119 i~FVGDSl~Rn~~~SL~clL~~~  141 (178)
                      ++|+|||+.|.+|--|+|+|...
T Consensus         2 v~~lgds~~ravykdlv~l~q~~   24 (183)
T cd01842           2 VVILGDSIQRAVYKDLVLLLQKD   24 (183)
T ss_pred             EEEEccHHHHHHHHHHHHHhcCC
Confidence            78999999999999999999854


No 5  
>COG2845 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=85.72  E-value=0.88  Score=41.46  Aligned_cols=30  Identities=20%  Similarity=0.162  Sum_probs=24.8

Q ss_pred             HHHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          111 LSLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       111 l~~lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      .+.=.+++|.|||||+++.+-..|...|..
T Consensus       111 ~k~~~a~kvLvvGDslm~gla~gl~~al~t  140 (354)
T COG2845         111 AKSRDADKVLVVGDSLMQGLAEGLDKALAT  140 (354)
T ss_pred             hhCCCCCEEEEechHHhhhhHHHHHHHhcc
Confidence            344458999999999999999998887764


No 6  
>cd01829 SGNH_hydrolase_peri2 SGNH_peri2; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=84.77  E-value=0.83  Score=35.95  Aligned_cols=22  Identities=27%  Similarity=0.434  Sum_probs=18.2

Q ss_pred             cEEEEecchhhHHHHHHHHhhh
Q 030408          118 NIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       118 ~i~FVGDSl~Rn~~~SL~clL~  139 (178)
                      ||+|+|||++.+...++...+.
T Consensus         1 ril~iGDS~~~g~~~~l~~~~~   22 (200)
T cd01829           1 RVLVIGDSLAQGLAPGLLRALA   22 (200)
T ss_pred             CEEEEechHHHHHHHHHHHHhc
Confidence            6899999999998877775554


No 7  
>cd01834 SGNH_hydrolase_like_2 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=84.39  E-value=0.51  Score=36.31  Aligned_cols=15  Identities=27%  Similarity=0.536  Sum_probs=13.9

Q ss_pred             CCcEEEEecchhhHH
Q 030408          116 NKNIGFVGDSLNENF  130 (178)
Q Consensus       116 gk~i~FVGDSl~Rn~  130 (178)
                      |++|+++|||++.+.
T Consensus         1 ~~~v~~~GDSit~g~   15 (191)
T cd01834           1 GDRIVFIGNSITDRG   15 (191)
T ss_pred             CCEEEEeCCChhhcc
Confidence            799999999999976


No 8  
>cd01841 NnaC_like NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.
Probab=82.73  E-value=0.63  Score=35.93  Aligned_cols=17  Identities=53%  Similarity=0.728  Sum_probs=13.5

Q ss_pred             CcEEEEecchhhHHHHH
Q 030408          117 KNIGFVGDSLNENFIVS  133 (178)
Q Consensus       117 k~i~FVGDSl~Rn~~~S  133 (178)
                      |+|+|+|||++.+.-..
T Consensus         1 ~~iv~~GdS~t~~~~~~   17 (174)
T cd01841           1 KNIVFIGDSLFEGWPLY   17 (174)
T ss_pred             CCEEEEcchhhhcCchh
Confidence            68999999999865433


No 9  
>cd01825 SGNH_hydrolase_peri1 SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=72.71  E-value=1.6  Score=33.71  Aligned_cols=18  Identities=33%  Similarity=0.479  Sum_probs=13.1

Q ss_pred             cEEEEecchhhH-HHHHHH
Q 030408          118 NIGFVGDSLNEN-FIVSFL  135 (178)
Q Consensus       118 ~i~FVGDSl~Rn-~~~SL~  135 (178)
                      ||+|+|||++-. .|-+.+
T Consensus         1 ~iv~~GDS~t~g~~~~~~l   19 (189)
T cd01825           1 RIAQLGDSHIAGDFFTDVL   19 (189)
T ss_pred             CeeEecCccccccchhhHH
Confidence            799999999963 344443


No 10 
>cd01844 SGNH_hydrolase_like_6 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=70.93  E-value=2  Score=33.58  Aligned_cols=13  Identities=23%  Similarity=0.314  Sum_probs=11.4

Q ss_pred             cEEEEecchhhHH
Q 030408          118 NIGFVGDSLNENF  130 (178)
Q Consensus       118 ~i~FVGDSl~Rn~  130 (178)
                      ||+|+|||++.+.
T Consensus         1 ~iv~~GDSit~G~   13 (177)
T cd01844           1 PWVFYGTSISQGA   13 (177)
T ss_pred             CEEEEeCchhcCc
Confidence            6999999998865


No 11 
>cd01838 Isoamyl_acetate_hydrolase_like Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash.  The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases
Probab=70.92  E-value=1.9  Score=33.36  Aligned_cols=13  Identities=31%  Similarity=0.417  Sum_probs=11.4

Q ss_pred             cEEEEecchhhHH
Q 030408          118 NIGFVGDSLNENF  130 (178)
Q Consensus       118 ~i~FVGDSl~Rn~  130 (178)
                      ||+|+|||++.+.
T Consensus         1 ~i~~~GDSit~g~   13 (199)
T cd01838           1 KIVLFGDSITQFS   13 (199)
T ss_pred             CEEEecCcccccc
Confidence            6999999999864


No 12 
>cd01835 SGNH_hydrolase_like_3 SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=69.47  E-value=2.1  Score=33.64  Aligned_cols=13  Identities=46%  Similarity=0.470  Sum_probs=11.7

Q ss_pred             CcEEEEecchhhH
Q 030408          117 KNIGFVGDSLNEN  129 (178)
Q Consensus       117 k~i~FVGDSl~Rn  129 (178)
                      ++|+|+|||++..
T Consensus         2 ~~i~~lGDSit~G   14 (193)
T cd01835           2 KRLIVVGDSLVYG   14 (193)
T ss_pred             cEEEEEcCccccC
Confidence            6899999999975


No 13 
>cd01832 SGNH_hydrolase_like_1 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
Probab=67.72  E-value=2.3  Score=32.92  Aligned_cols=11  Identities=36%  Similarity=0.492  Sum_probs=10.0

Q ss_pred             cEEEEecchhh
Q 030408          118 NIGFVGDSLNE  128 (178)
Q Consensus       118 ~i~FVGDSl~R  128 (178)
                      ||+|+|||++.
T Consensus         1 ~i~~~GDSit~   11 (185)
T cd01832           1 RYVALGDSITE   11 (185)
T ss_pred             CeeEecchhhc
Confidence            69999999996


No 14 
>PF00185 OTCace:  Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain;  InterPro: IPR006131 This family contains two related enzymes:  Aspartate carbamoyltransferase (2.1.3.2 from EC) (ATCase) catalyzes the conversion of aspartate and carbamoyl phosphate to carbamoylaspartate, the second step in the de novo biosynthesis of pyrimidine nucleotides []. In prokaryotes ATCase consists of two subunits: a catalytic chain (gene pyrB) and a regulatory chain (gene pyrI), while in eukaryotes it is a domain in a multi- functional enzyme (called URA2 in yeast, rudimentary in Drosophila, and CAD in mammals []) that also catalyzes other steps of the biosynthesis of pyrimidines. Ornithine carbamoyltransferase (2.1.3.3 from EC) (OTCase) catalyzes the conversion of ornithine and carbamoyl phosphate to citrulline. In mammals this enzyme participates in the urea cycle [] and is located in the mitochondrial matrix. In prokaryotes and eukaryotic microorganisms it is involved in the biosynthesis of arginine. In some bacterial species it is also involved in the degradation of arginine [] (the arginine deaminase pathway).  It has been shown [] that these two enzymes are evolutionary related. The predicted secondary structure of both enzymes are similar and there are some regions of sequence similarities. One of these regions includes three residues which have been shown, by crystallographic studies [], to be implicated in binding the phosphoryl group of carbamoyl phosphate and is described by IPR006132 from INTERPRO. The carboxyl-terminal, aspartate/ornithine-binding domain is connected to the amino-terminal domain by two alpha-helices, which comprise a hinge between domains [].; GO: 0016597 amino acid binding, 0016743 carboxyl- or carbamoyltransferase activity, 0006520 cellular amino acid metabolic process; PDB: 1ML4_A 4EP1_B 3Q98_A 3E2P_A 2RGW_E 4EKN_B 2G7M_E 3D6N_B 3M4J_A 3L06_A ....
Probab=67.07  E-value=4.4  Score=32.21  Aligned_cols=25  Identities=24%  Similarity=0.404  Sum_probs=21.1

Q ss_pred             cCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          115 RNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       115 rgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      .|++|+|||| ..-|...|++.++..
T Consensus         1 ~gl~i~~vGD-~~~rv~~Sl~~~~~~   25 (158)
T PF00185_consen    1 KGLKIAYVGD-GHNRVAHSLIELLAK   25 (158)
T ss_dssp             TTEEEEEESS-TTSHHHHHHHHHHHH
T ss_pred             CCCEEEEECC-CCChHHHHHHHHHHH
Confidence            4899999999 667888999988774


No 15 
>cd01820 PAF_acetylesterase_like PAF_acetylhydrolase (PAF-AH)_like subfamily of SGNH-hydrolases. Platelet-activating factor (PAF) and PAF-AH are key players in inflammation and in atherosclerosis. PAF-AH is a calcium independent phospholipase A2 which exhibits strong substrate specificity towards PAF, hydrolyzing an acetyl ester at the sn-2 position. PAF-AH also degrades a family of oxidized PAF-like phospholipids with short sn-2 residues.  In addition,  PAF and PAF-AH are associated with neural migration and mammalian reproduction.
Probab=67.04  E-value=4.4  Score=32.74  Aligned_cols=15  Identities=33%  Similarity=0.851  Sum_probs=12.9

Q ss_pred             CCcEEEEecchhhHH
Q 030408          116 NKNIGFVGDSLNENF  130 (178)
Q Consensus       116 gk~i~FVGDSl~Rn~  130 (178)
                      ..+|+|+|||++...
T Consensus        32 ~~~iv~lGDSit~g~   46 (214)
T cd01820          32 EPDVVFIGDSITQNW   46 (214)
T ss_pred             CCCEEEECchHhhhh
Confidence            458999999999974


No 16 
>PRK10528 multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1; Provisional
Probab=63.04  E-value=4  Score=32.66  Aligned_cols=15  Identities=27%  Similarity=0.574  Sum_probs=12.9

Q ss_pred             CCcEEEEecchhhHH
Q 030408          116 NKNIGFVGDSLNENF  130 (178)
Q Consensus       116 gk~i~FVGDSl~Rn~  130 (178)
                      +.+|+|+|||++.+.
T Consensus        10 ~~~iv~~GDSit~G~   24 (191)
T PRK10528         10 ADTLLILGDSLSAGY   24 (191)
T ss_pred             CCEEEEEeCchhhcC
Confidence            679999999999763


No 17 
>cd01827 sialate_O-acetylesterase_like1 sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=62.52  E-value=3.9  Score=31.78  Aligned_cols=13  Identities=31%  Similarity=0.590  Sum_probs=10.7

Q ss_pred             cEEEEecchhhHH
Q 030408          118 NIGFVGDSLNENF  130 (178)
Q Consensus       118 ~i~FVGDSl~Rn~  130 (178)
                      ||+|+|||++...
T Consensus         2 ~i~~~GDSit~G~   14 (188)
T cd01827           2 KVACVGNSITEGA   14 (188)
T ss_pred             eEEEEeccccccc
Confidence            7999999996653


No 18 
>cd01822 Lysophospholipase_L1_like Lysophospholipase L1-like subgroup of SGNH-hydrolases. The best characterized member in this family is TesA, an E. coli periplasmic protein with thioesterase, esterase, arylesterase, protease and lysophospholipase activity.
Probab=61.76  E-value=4  Score=31.16  Aligned_cols=12  Identities=42%  Similarity=0.501  Sum_probs=10.4

Q ss_pred             cEEEEecchhhH
Q 030408          118 NIGFVGDSLNEN  129 (178)
Q Consensus       118 ~i~FVGDSl~Rn  129 (178)
                      ||+|+|||++-.
T Consensus         2 ~i~~~GDSit~G   13 (177)
T cd01822           2 TILALGDSLTAG   13 (177)
T ss_pred             eEEEEccccccC
Confidence            799999999755


No 19 
>cd01833 XynB_like SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=61.00  E-value=3.2  Score=31.36  Aligned_cols=12  Identities=33%  Similarity=0.327  Sum_probs=10.1

Q ss_pred             cEEEEecchhhH
Q 030408          118 NIGFVGDSLNEN  129 (178)
Q Consensus       118 ~i~FVGDSl~Rn  129 (178)
                      +|++||||++-.
T Consensus         2 ~~~~~Gds~~~g   13 (157)
T cd01833           2 RIMPLGDSITWG   13 (157)
T ss_pred             ceeecCCceeec
Confidence            689999998765


No 20 
>cd01831 Endoglucanase_E_like Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
Probab=60.79  E-value=4.4  Score=31.37  Aligned_cols=15  Identities=40%  Similarity=0.718  Sum_probs=11.9

Q ss_pred             cEEEEecchhhHHHH
Q 030408          118 NIGFVGDSLNENFIV  132 (178)
Q Consensus       118 ~i~FVGDSl~Rn~~~  132 (178)
                      +|+|+|||++-..-.
T Consensus         1 ~i~~iGDSit~G~~~   15 (169)
T cd01831           1 KIEFIGDSITCGYGV   15 (169)
T ss_pred             CEEEEeccccccCcc
Confidence            589999999986443


No 21 
>PF09949 DUF2183:  Uncharacterized conserved protein (DUF2183);  InterPro: IPR019236  This domain, found in various bacterial and fungal proteins, has no known function. 
Probab=60.64  E-value=7.6  Score=29.18  Aligned_cols=24  Identities=17%  Similarity=0.284  Sum_probs=18.7

Q ss_pred             ChHHHHHHhcCCcEEEEecchhhH
Q 030408          106 DPVKFLSLMRNKNIGFVGDSLNEN  129 (178)
Q Consensus       106 d~~~fl~~lrgk~i~FVGDSl~Rn  129 (178)
                      .-.++++.+-++++++||||--.-
T Consensus        54 ~i~~i~~~fP~~kfiLIGDsgq~D   77 (100)
T PF09949_consen   54 NIERILRDFPERKFILIGDSGQHD   77 (100)
T ss_pred             HHHHHHHHCCCCcEEEEeeCCCcC
Confidence            345677778899999999996553


No 22 
>cd00229 SGNH_hydrolase SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=58.09  E-value=3.7  Score=29.72  Aligned_cols=18  Identities=28%  Similarity=0.294  Sum_probs=13.4

Q ss_pred             EEEEecchhhHHHHHHHH
Q 030408          119 IGFVGDSLNENFIVSFLC  136 (178)
Q Consensus       119 i~FVGDSl~Rn~~~SL~c  136 (178)
                      |+|+|||++.+.......
T Consensus         1 i~~~GDS~~~g~~~~~~~   18 (187)
T cd00229           1 ILVIGDSITAGYGASSGS   18 (187)
T ss_pred             CeeeccccccccCCCCCC
Confidence            689999999876554443


No 23 
>PF12026 DUF3513:  Domain of unknown function (DUF3513);  InterPro: IPR021901  This presumed domain is functionally uncharacterised. This domain is found in eukaryotes. This domain is typically between 192 to 218 amino acids in length. This domain is found associated with PF00018 from PFAM, PF08824 from PFAM. This domain has a conserved QPP sequence motif. ; PDB: 3T6G_D 1X27_N.
Probab=57.18  E-value=0.65  Score=39.57  Aligned_cols=17  Identities=24%  Similarity=0.536  Sum_probs=14.0

Q ss_pred             hcCCcEEEEecchhhHH
Q 030408          114 MRNKNIGFVGDSLNENF  130 (178)
Q Consensus       114 lrgk~i~FVGDSl~Rn~  130 (178)
                      |.|-++|||||++.|+.
T Consensus       132 l~ahkLVfiGDTl~r~~  148 (210)
T PF12026_consen  132 LSAHKLVFIGDTLCREA  148 (210)
T ss_dssp             HHHHHHHHHHHHHHHC-
T ss_pred             EEeeeeeeeccHHHHHh
Confidence            55889999999999864


No 24 
>cd04501 SGNH_hydrolase_like_4 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=55.51  E-value=5.7  Score=30.78  Aligned_cols=12  Identities=25%  Similarity=0.385  Sum_probs=10.4

Q ss_pred             CcEEEEecchhh
Q 030408          117 KNIGFVGDSLNE  128 (178)
Q Consensus       117 k~i~FVGDSl~R  128 (178)
                      .||+|+|||++.
T Consensus         1 ~~i~~~GDSi~~   12 (183)
T cd04501           1 MRVVCLGDSITY   12 (183)
T ss_pred             CeEEEEcccccc
Confidence            379999999995


No 25 
>cd01836 FeeA_FeeB_like SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=53.79  E-value=6.8  Score=30.56  Aligned_cols=14  Identities=21%  Similarity=0.261  Sum_probs=11.9

Q ss_pred             CcEEEEecchhhHH
Q 030408          117 KNIGFVGDSLNENF  130 (178)
Q Consensus       117 k~i~FVGDSl~Rn~  130 (178)
                      .||+|+|||++-..
T Consensus         3 ~~i~~~GDSit~G~   16 (191)
T cd01836           3 LRLLVLGDSTAAGV   16 (191)
T ss_pred             eEEEEEeccccccc
Confidence            37999999999774


No 26 
>cd01828 sialate_O-acetylesterase_like2 sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=53.45  E-value=6.1  Score=30.29  Aligned_cols=15  Identities=40%  Similarity=0.468  Sum_probs=11.8

Q ss_pred             EEEEecchhhHHHHH
Q 030408          119 IGFVGDSLNENFIVS  133 (178)
Q Consensus       119 i~FVGDSl~Rn~~~S  133 (178)
                      |+|+|||+++..-+.
T Consensus         2 v~~~GdSi~~~~~~~   16 (169)
T cd01828           2 LVFLGDSLTEGGPWA   16 (169)
T ss_pred             EEEecchhhccCcHH
Confidence            789999999765433


No 27 
>cd01830 XynE_like SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=52.61  E-value=7.3  Score=31.16  Aligned_cols=12  Identities=25%  Similarity=0.559  Sum_probs=10.3

Q ss_pred             cEEEEecchhhH
Q 030408          118 NIGFVGDSLNEN  129 (178)
Q Consensus       118 ~i~FVGDSl~Rn  129 (178)
                      +|+|+|||++.+
T Consensus         1 ~iv~~GDSiT~G   12 (204)
T cd01830           1 SVVALGDSITDG   12 (204)
T ss_pred             CEEEEecccccC
Confidence            589999999964


No 28 
>cd01839 SGNH_arylesterase_like SGNH_hydrolase subfamily, similar to arylesterase (7-aminocephalosporanic acid-deacetylating enzyme) of A. tumefaciens. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
Probab=52.51  E-value=7.4  Score=31.02  Aligned_cols=13  Identities=31%  Similarity=0.194  Sum_probs=11.1

Q ss_pred             cEEEEecchhhHH
Q 030408          118 NIGFVGDSLNENF  130 (178)
Q Consensus       118 ~i~FVGDSl~Rn~  130 (178)
                      +|+|+|||++..-
T Consensus         1 ~I~~~GDSiT~G~   13 (208)
T cd01839           1 TILCFGDSNTWGI   13 (208)
T ss_pred             CEEEEecCcccCC
Confidence            5899999999863


No 29 
>PRK14805 ornithine carbamoyltransferase; Provisional
Probab=52.26  E-value=10  Score=33.54  Aligned_cols=27  Identities=19%  Similarity=0.298  Sum_probs=21.6

Q ss_pred             HHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          112 SLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       112 ~~lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      ..++|++|+||||.  +|...|++.++..
T Consensus       143 g~l~g~kva~vGD~--~~v~~S~~~~~~~  169 (302)
T PRK14805        143 GDVSKVKLAYVGDG--NNVTHSLMYGAAI  169 (302)
T ss_pred             CCcCCcEEEEEcCC--CccHHHHHHHHHH
Confidence            34789999999994  5688998888764


No 30 
>cd01821 Rhamnogalacturan_acetylesterase_like Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
Probab=51.03  E-value=7.3  Score=30.79  Aligned_cols=15  Identities=27%  Similarity=0.293  Sum_probs=12.4

Q ss_pred             cEEEEecchhhHHHH
Q 030408          118 NIGFVGDSLNENFIV  132 (178)
Q Consensus       118 ~i~FVGDSl~Rn~~~  132 (178)
                      +|+|+|||++.+...
T Consensus         2 ~i~~~GDS~t~G~~~   16 (198)
T cd01821           2 TIFLAGDSTVADYDP   16 (198)
T ss_pred             EEEEEecCCcccCCC
Confidence            689999999987643


No 31 
>PRK04284 ornithine carbamoyltransferase; Provisional
Probab=48.94  E-value=14  Score=33.24  Aligned_cols=27  Identities=19%  Similarity=0.265  Sum_probs=21.6

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          113 LMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       113 ~lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      .+.|++|+||||..+ |...|++.++..
T Consensus       152 ~l~g~kia~vGD~~~-~v~~Sl~~~~~~  178 (332)
T PRK04284        152 PYKDIKFTYVGDGRN-NVANALMQGAAI  178 (332)
T ss_pred             CcCCcEEEEecCCCc-chHHHHHHHHHH
Confidence            367999999999766 488888887763


No 32 
>cd04502 SGNH_hydrolase_like_7 Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
Probab=47.40  E-value=9.3  Score=29.36  Aligned_cols=14  Identities=29%  Similarity=0.171  Sum_probs=11.2

Q ss_pred             EEEEecchhhHHHH
Q 030408          119 IGFVGDSLNENFIV  132 (178)
Q Consensus       119 i~FVGDSl~Rn~~~  132 (178)
                      |+|||||+.+.--.
T Consensus         2 i~~~g~s~~~~w~~   15 (171)
T cd04502           2 ILFYGSSSIRLWDT   15 (171)
T ss_pred             EEEEcCchhcchhh
Confidence            79999999886543


No 33 
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional
Probab=43.76  E-value=18  Score=32.03  Aligned_cols=28  Identities=18%  Similarity=0.208  Sum_probs=22.2

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          113 LMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       113 ~lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      .++|++|+||||-..-|...|++.++..
T Consensus       153 ~l~g~kv~~vGD~~~~~v~~Sl~~~~~~  180 (305)
T PRK00856        153 RLEGLKVAIVGDIKHSRVARSNIQALTR  180 (305)
T ss_pred             CCCCCEEEEECCCCCCcHHHHHHHHHHH
Confidence            4789999999997655778888777663


No 34 
>PF00702 Hydrolase:  haloacid dehalogenase-like hydrolase;  InterPro: IPR005834  This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase). This group includes L-2-haloacid dehalogenase, epoxide hydrolases and phosphatases. The structure consists of two domains. One is an inserted four helix bundle, which is the least well conserved region of the alignment, between residues 16 and 96 of HAD1_PSESP. The rest of the fold is composed of the core alpha/beta domain.; GO: 0003824 catalytic activity, 0008152 metabolic process; PDB: 1TE2_A 3NAL_A 3NAM_A 3NAN_A 3A1D_B 3J09_A 3J08_A 2B8E_C 3A1E_A 2VOY_J ....
Probab=43.25  E-value=20  Score=27.85  Aligned_cols=20  Identities=20%  Similarity=0.579  Sum_probs=15.4

Q ss_pred             HHHHHHhc--CCcEEEEecchh
Q 030408          108 VKFLSLMR--NKNIGFVGDSLN  127 (178)
Q Consensus       108 ~~fl~~lr--gk~i~FVGDSl~  127 (178)
                      ..+.+.|+  +.++++|||+++
T Consensus       185 ~~~i~~l~~~~~~v~~vGDg~n  206 (215)
T PF00702_consen  185 LRIIKELQVKPGEVAMVGDGVN  206 (215)
T ss_dssp             HHHHHHHTCTGGGEEEEESSGG
T ss_pred             HHHHHHHhcCCCEEEEEccCHH
Confidence            45667765  569999999984


No 35 
>PRK02102 ornithine carbamoyltransferase; Validated
Probab=42.12  E-value=21  Score=32.15  Aligned_cols=27  Identities=22%  Similarity=0.348  Sum_probs=21.6

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          113 LMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       113 ~lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      .++|++|++|||..+ |...|++.++..
T Consensus       152 ~l~g~~va~vGd~~~-~v~~Sl~~~~~~  178 (331)
T PRK02102        152 PLKGLKLAYVGDGRN-NMANSLMVGGAK  178 (331)
T ss_pred             CCCCCEEEEECCCcc-cHHHHHHHHHHH
Confidence            367999999999865 488888887763


No 36 
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase. Note that SP|P53981 from S. cerevisiae, a member of this family, is annotated as a "probable membrane protein" due to a predicted transmembrane helix. The region in question contains the second of the three conserved HAD superfamily catalytic motifs and thus, considering the fold of the HAD catalytic domain, is unlikely to be a transmembrane region in fact.
Probab=42.01  E-value=28  Score=26.64  Aligned_cols=13  Identities=23%  Similarity=0.659  Sum_probs=10.8

Q ss_pred             CCcEEEEecchhh
Q 030408          116 NKNIGFVGDSLNE  128 (178)
Q Consensus       116 gk~i~FVGDSl~R  128 (178)
                      .++++|||||.+=
T Consensus       162 ~~~~i~iGD~~~D  174 (188)
T TIGR01489       162 YQHIIYIGDGVTD  174 (188)
T ss_pred             CceEEEECCCcch
Confidence            5689999999764


No 37 
>PLN02527 aspartate carbamoyltransferase
Probab=41.75  E-value=21  Score=31.60  Aligned_cols=27  Identities=26%  Similarity=0.401  Sum_probs=20.9

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhh
Q 030408          113 LMRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       113 ~lrgk~i~FVGDSl~Rn~~~SL~clL~  139 (178)
                      .++|.+|+||||-.+-+...|++-.+.
T Consensus       148 ~l~g~kva~vGD~~~~rv~~Sl~~~~~  174 (306)
T PLN02527        148 RLDGIKVGLVGDLANGRTVRSLAYLLA  174 (306)
T ss_pred             CcCCCEEEEECCCCCChhHHHHHHHHH
Confidence            367999999999865467778777654


No 38 
>cd04506 SGNH_hydrolase_YpmR_like Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
Probab=40.97  E-value=14  Score=29.21  Aligned_cols=12  Identities=50%  Similarity=0.639  Sum_probs=10.7

Q ss_pred             cEEEEecchhhH
Q 030408          118 NIGFVGDSLNEN  129 (178)
Q Consensus       118 ~i~FVGDSl~Rn  129 (178)
                      +|+|+|||++..
T Consensus         1 ~i~~~GDSit~G   12 (204)
T cd04506           1 KIVALGDSLTEG   12 (204)
T ss_pred             CEeEEeccccCc
Confidence            589999999996


No 39 
>PRK01713 ornithine carbamoyltransferase; Provisional
Probab=39.36  E-value=24  Score=31.69  Aligned_cols=26  Identities=23%  Similarity=0.304  Sum_probs=20.5

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          114 MRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       114 lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      +.|++|+||||-.+ |...|++.++..
T Consensus       154 l~gl~ia~vGD~~~-~v~~Sl~~~~~~  179 (334)
T PRK01713        154 LSEISYVYIGDARN-NMGNSLLLIGAK  179 (334)
T ss_pred             cCCcEEEEECCCcc-CHHHHHHHHHHH
Confidence            67899999999654 488888877763


No 40 
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism]
Probab=38.93  E-value=23  Score=32.02  Aligned_cols=21  Identities=29%  Similarity=0.581  Sum_probs=18.5

Q ss_pred             hcCCcEEEEecchhhHHHHHHHH
Q 030408          114 MRNKNIGFVGDSLNENFIVSFLC  136 (178)
Q Consensus       114 lrgk~i~FVGDSl~Rn~~~SL~c  136 (178)
                      ++|++++||||-  -|+-.||+-
T Consensus       151 l~g~k~a~vGDg--NNv~nSl~~  171 (310)
T COG0078         151 LKGLKLAYVGDG--NNVANSLLL  171 (310)
T ss_pred             ccCcEEEEEcCc--chHHHHHHH
Confidence            689999999998  888888865


No 41 
>cd01840 SGNH_hydrolase_yrhL_like yrhL-like subfamily of SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Most members of this sub-family appear to co-occur with N-terminal acyltransferase domains. Might be involved in lipid metabolism.
Probab=38.63  E-value=24  Score=26.99  Aligned_cols=20  Identities=20%  Similarity=0.225  Sum_probs=14.1

Q ss_pred             EEEEecchhhHHHHHHHHhh
Q 030408          119 IGFVGDSLNENFIVSFLCVL  138 (178)
Q Consensus       119 i~FVGDSl~Rn~~~SL~clL  138 (178)
                      |.|+|||++-..-..+...+
T Consensus         2 v~~~GDSv~~~~~~~~~~~~   21 (150)
T cd01840           2 ITAIGDSVMLDSSPALQEIF   21 (150)
T ss_pred             eeEEeehHHHchHHHHHHHC
Confidence            78999999987655544433


No 42 
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]
Probab=38.30  E-value=19  Score=34.33  Aligned_cols=32  Identities=22%  Similarity=0.299  Sum_probs=24.5

Q ss_pred             HHHHhcCCcEEEEecchhhHH-HHHHHHhhhhc
Q 030408          110 FLSLMRNKNIGFVGDSLNENF-IVSFLCVLRAA  141 (178)
Q Consensus       110 fl~~lrgk~i~FVGDSl~Rn~-~~SL~clL~~~  141 (178)
                      +.+.++||||+.|=||+.|.- ...++.||+.+
T Consensus       342 vr~~v~GKrVvlVDDSIVRGTTsr~IV~mlReA  374 (470)
T COG0034         342 VREVVKGKRVVLVDDSIVRGTTSRRIVQMLREA  374 (470)
T ss_pred             hHHHhCCCeEEEEccccccCccHHHHHHHHHHh
Confidence            455688999999999999863 45567777743


No 43 
>PF01861 DUF43:  Protein of unknown function DUF43;  InterPro: IPR002723 This family of prokaryotic proteins have not been characterised. All the members are 350-400 amino acids long.; PDB: 2QM3_A.
Probab=37.89  E-value=15  Score=32.03  Aligned_cols=12  Identities=42%  Similarity=0.758  Sum_probs=8.8

Q ss_pred             hcCCcEEEEecc
Q 030408          114 MRNKNIGFVGDS  125 (178)
Q Consensus       114 lrgk~i~FVGDS  125 (178)
                      |.||+|+||||=
T Consensus        43 L~gk~il~lGDD   54 (243)
T PF01861_consen   43 LEGKRILFLGDD   54 (243)
T ss_dssp             STT-EEEEES-T
T ss_pred             ccCCEEEEEcCC
Confidence            679999999993


No 44 
>PLN02342 ornithine carbamoyltransferase
Probab=36.39  E-value=29  Score=31.55  Aligned_cols=26  Identities=23%  Similarity=0.482  Sum_probs=21.3

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          113 LMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       113 ~lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      .+.|++|++|||-  .|...|++.++..
T Consensus       191 ~l~glkva~vGD~--~nva~Sli~~~~~  216 (348)
T PLN02342        191 RLEGTKVVYVGDG--NNIVHSWLLLAAV  216 (348)
T ss_pred             CcCCCEEEEECCC--chhHHHHHHHHHH
Confidence            4779999999995  3699999888763


No 45 
>PRK08192 aspartate carbamoyltransferase; Provisional
Probab=35.75  E-value=28  Score=31.35  Aligned_cols=26  Identities=23%  Similarity=0.230  Sum_probs=20.3

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhh
Q 030408          114 MRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       114 lrgk~i~FVGDSl~Rn~~~SL~clL~  139 (178)
                      +.|++|+||||-..-|...|++.+|.
T Consensus       157 l~g~kia~vGD~~~~rv~~Sl~~~l~  182 (338)
T PRK08192        157 IDGMHIAMVGDLKFGRTVHSLSRLLC  182 (338)
T ss_pred             cCCCEEEEECcCCCCchHHHHHHHHH
Confidence            67899999999765577788776654


No 46 
>COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism]
Probab=34.11  E-value=13  Score=33.67  Aligned_cols=45  Identities=18%  Similarity=0.135  Sum_probs=37.1

Q ss_pred             eCCCCCCCCCChHHHHHHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408           96 VPEACDLPQIDPVKFLSLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus        96 qP~gC~lp~fd~~~fl~~lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      .|.++.|--|+-.+-...+.|++|++|||-.--.-.-|++.+|..
T Consensus       138 HPTQ~LLDl~TI~~~~G~~~gl~iaivGDlkhsRva~S~~~~L~~  182 (316)
T COG0540         138 HPTQALLDLYTIREEFGRLDGLKIAIVGDLKHSRVAHSNIQALKR  182 (316)
T ss_pred             CccHHHHHHHHHHHHhCCcCCcEEEEEccccchHHHHHHHHHHHH
Confidence            477777777777777777899999999999888888888888874


No 47 
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase. Ornithine carbamoyltransferases are in the same superfamily and form an outgroup.
Probab=33.59  E-value=26  Score=31.04  Aligned_cols=29  Identities=21%  Similarity=0.198  Sum_probs=22.2

Q ss_pred             HHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          112 SLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       112 ~~lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      ..++|++|+||||...-|...|++-++..
T Consensus       146 g~l~g~~va~vGD~~~~~v~~Sl~~~~a~  174 (301)
T TIGR00670       146 GRLDGLKIALVGDLKYGRTVHSLAEALTR  174 (301)
T ss_pred             CCCCCCEEEEEccCCCCcHHHHHHHHHHH
Confidence            34789999999997655777787776653


No 48 
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional
Probab=33.57  E-value=34  Score=30.87  Aligned_cols=26  Identities=23%  Similarity=0.273  Sum_probs=20.6

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          114 MRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       114 lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      ++|.+|++|||..+ |...|++.++..
T Consensus       154 l~gl~va~vGD~~~-~v~~S~~~~~~~  179 (334)
T PRK12562        154 FNEMTLVYAGDARN-NMGNSMLEAAAL  179 (334)
T ss_pred             cCCcEEEEECCCCC-CHHHHHHHHHHH
Confidence            57899999999865 488888877653


No 49 
>PRK11891 aspartate carbamoyltransferase; Provisional
Probab=31.66  E-value=38  Score=31.77  Aligned_cols=26  Identities=23%  Similarity=0.321  Sum_probs=20.3

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhh
Q 030408          114 MRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       114 lrgk~i~FVGDSl~Rn~~~SL~clL~  139 (178)
                      ++|++|+||||-..-|...|++.++.
T Consensus       239 l~G~kIa~vGD~~~~rv~~Sl~~~la  264 (429)
T PRK11891        239 VDGAHIALVGDLKYGRTVHSLVKLLA  264 (429)
T ss_pred             cCCCEEEEECcCCCChHHHHHHHHHH
Confidence            56899999999865577788777654


No 50 
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=30.40  E-value=46  Score=25.93  Aligned_cols=16  Identities=44%  Similarity=0.698  Sum_probs=11.8

Q ss_pred             HHHHhcC-CcEEEEecc
Q 030408          110 FLSLMRN-KNIGFVGDS  125 (178)
Q Consensus       110 fl~~lrg-k~i~FVGDS  125 (178)
                      +.-+.++ |++++|||.
T Consensus       210 l~~l~~~~~~~vlvGD~  226 (236)
T PF13086_consen  210 LIPLSRAPKRIVLVGDP  226 (236)
T ss_dssp             HHHHTTTBSEEEEEE-T
T ss_pred             HHHHHHhCCEEEEECCh
Confidence            4456778 999999995


No 51 
>PF04954 SIP:  Siderophore-interacting protein;  InterPro: IPR007037 This entry includes the vibriobactin utilization protein viuB, which is involved in the removal of iron from iron-vibriobactin complexes, as well as several hypothetical proteins.; PDB: 2GPJ_A.
Probab=29.90  E-value=1.1e+02  Score=22.91  Aligned_cols=23  Identities=26%  Similarity=0.206  Sum_probs=19.7

Q ss_pred             CcEEEEecchhhHHHHHHHHhhh
Q 030408          117 KNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       117 k~i~FVGDSl~Rn~~~SL~clL~  139 (178)
                      ++++||||.++---..+++.-|.
T Consensus         2 ~~~ll~gDeTalPAi~~iLe~lp   24 (119)
T PF04954_consen    2 DRYLLVGDETALPAIARILEALP   24 (119)
T ss_dssp             SEEEEEEEGGGHHHHHHHHHHS-
T ss_pred             ceEEEEeccccHHHHHHHHHhCC
Confidence            57899999999999999888774


No 52 
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional
Probab=29.66  E-value=43  Score=30.18  Aligned_cols=26  Identities=23%  Similarity=0.327  Sum_probs=20.4

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          114 MRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       114 lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      +.|.+|+||||-.+ |...|++-++..
T Consensus       154 l~g~~ia~vGD~~~-~v~~Sl~~~~~~  179 (336)
T PRK03515        154 FNEMTLAYAGDARN-NMGNSLLEAAAL  179 (336)
T ss_pred             cCCCEEEEeCCCcC-cHHHHHHHHHHH
Confidence            56899999999544 588888887763


No 53 
>PF00657 Lipase_GDSL:  GDSL-like Lipase/Acylhydrolase;  InterPro: IPR001087 A variety of lipolytic enzymes with serine as part of the active site have been identified []. Members of this entry include; Aeromonas hydrophila lipase, Vibrio mimicus arylesterase, Vibrio parahaemolyticus thermolabile haemolysin, rabbit phospholipase (AdRab-B), and Brassica napus anter-specific proline-rich protein.; GO: 0016788 hydrolase activity, acting on ester bonds, 0006629 lipid metabolic process; PDB: 2WAO_A 2WAB_A 1V2G_A 1U8U_A 1JRL_A 1IVN_A 1J00_A 1DEO_A 1K7C_A 1PP4_A ....
Probab=29.49  E-value=28  Score=27.07  Aligned_cols=11  Identities=45%  Similarity=0.667  Sum_probs=10.1

Q ss_pred             EEEEecchhhH
Q 030408          119 IGFVGDSLNEN  129 (178)
Q Consensus       119 i~FVGDSl~Rn  129 (178)
                      |+++|||++-.
T Consensus         1 i~~fGDS~td~   11 (234)
T PF00657_consen    1 IVVFGDSLTDG   11 (234)
T ss_dssp             EEEEESHHHHT
T ss_pred             CEEEeehhccc
Confidence            68999999998


No 54 
>PF13242 Hydrolase_like:  HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B ....
Probab=29.22  E-value=56  Score=22.09  Aligned_cols=21  Identities=24%  Similarity=0.245  Sum_probs=15.5

Q ss_pred             cCCcEEEEecchhhHHHHHHH
Q 030408          115 RNKNIGFVGDSLNENFIVSFL  135 (178)
Q Consensus       115 rgk~i~FVGDSl~Rn~~~SL~  135 (178)
                      .-.++++||||+..-+--+-.
T Consensus        20 ~~~~~~~VGD~~~~Di~~a~~   40 (75)
T PF13242_consen   20 DPSRCVMVGDSLETDIEAAKA   40 (75)
T ss_dssp             GGGGEEEEESSTTTHHHHHHH
T ss_pred             CHHHEEEEcCCcHhHHHHHHH
Confidence            357899999997777665543


No 55 
>PRK00779 ornithine carbamoyltransferase; Provisional
Probab=28.46  E-value=41  Score=29.71  Aligned_cols=43  Identities=19%  Similarity=0.162  Sum_probs=27.3

Q ss_pred             eCCCCCCCCCChHHHHHHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408           96 VPEACDLPQIDPVKFLSLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus        96 qP~gC~lp~fd~~~fl~~lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      .|.+..+--|+-.+-...++|.+|++||| .+ +...|++.++..
T Consensus       132 HPtQaL~Dl~Ti~e~~g~l~gl~i~~vGd-~~-~v~~Sl~~~l~~  174 (304)
T PRK00779        132 HPCQILADLLTIYEHRGSLKGLKVAWVGD-GN-NVANSLLLAAAL  174 (304)
T ss_pred             ChHHHHHHHHHHHHHhCCcCCcEEEEEeC-CC-ccHHHHHHHHHH
Confidence            34443333333333344578999999999 34 478888887763


No 56 
>PRK14804 ornithine carbamoyltransferase; Provisional
Probab=28.30  E-value=46  Score=29.58  Aligned_cols=26  Identities=19%  Similarity=0.443  Sum_probs=20.0

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          113 LMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       113 ~lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      .++|++|++|||  .-|...|++-++..
T Consensus       150 ~l~g~~va~vGd--~~rv~~Sl~~~~~~  175 (311)
T PRK14804        150 PLNQKQLTYIGV--HNNVVNSLIGITAA  175 (311)
T ss_pred             CCCCCEEEEECC--CCcHHHHHHHHHHH
Confidence            478999999999  35677787776653


No 57 
>cd01823 SEST_like SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
Probab=26.93  E-value=32  Score=28.21  Aligned_cols=13  Identities=23%  Similarity=0.199  Sum_probs=10.2

Q ss_pred             CcEEEEecchhhH
Q 030408          117 KNIGFVGDSLNEN  129 (178)
Q Consensus       117 k~i~FVGDSl~Rn  129 (178)
                      .+++++|||++-+
T Consensus         1 ~~~v~iGDS~~~G   13 (259)
T cd01823           1 VRYVALGDSYAAG   13 (259)
T ss_pred             CCEEEecchhhcC
Confidence            3789999998754


No 58 
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase. Most OTCases are homotrimers, but the homotrimers are organized into dodecamers built from four trimers in at least two species; the catabolic OTCase of Pseudomonas aeruginosa is allosterically regulated, while OTCase of the extreme thermophile Pyrococcus furiosus shows both allostery and thermophily.
Probab=26.35  E-value=53  Score=28.99  Aligned_cols=25  Identities=24%  Similarity=0.396  Sum_probs=20.6

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          114 MRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       114 lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      +.|.+|++|||. + +...|++.++..
T Consensus       146 l~g~~v~~vGd~-~-~v~~Sl~~~l~~  170 (304)
T TIGR00658       146 LKGVKVVYVGDG-N-NVCNSLMLAGAK  170 (304)
T ss_pred             CCCcEEEEEeCC-C-chHHHHHHHHHH
Confidence            678999999996 3 588898888764


No 59 
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase. Members of this family are the methionine salvage enzyme MnxX, a member of the HAD-superfamily hydrolases, subfamily IB (see TIGR01488). Members are found in Bacillus subtilis and related species, paired with MtnW (TIGR03332). In most species that recycle methionine from methylthioadenosine, the single protein MtnC replaces the MtnW/MtnX pair. In B. subtilis, mtnX was first known as ykrX.
Probab=25.29  E-value=55  Score=26.46  Aligned_cols=14  Identities=29%  Similarity=0.406  Sum_probs=11.7

Q ss_pred             cCCcEEEEecchhh
Q 030408          115 RNKNIGFVGDSLNE  128 (178)
Q Consensus       115 rgk~i~FVGDSl~R  128 (178)
                      ++.++++||||.+=
T Consensus       155 ~~~~~i~iGDg~~D  168 (214)
T TIGR03333       155 PNDYHIVIGDSVTD  168 (214)
T ss_pred             cCCcEEEEeCCHHH
Confidence            56789999999876


No 60 
>KOG0572 consensus Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism]
Probab=25.09  E-value=36  Score=32.16  Aligned_cols=30  Identities=23%  Similarity=0.277  Sum_probs=23.8

Q ss_pred             HHhcCCcEEEEecchhhHH-HHHHHHhhhhc
Q 030408          112 SLMRNKNIGFVGDSLNENF-IVSFLCVLRAA  141 (178)
Q Consensus       112 ~~lrgk~i~FVGDSl~Rn~-~~SL~clL~~~  141 (178)
                      +-+.||||+.|-||+.|.- .--++.||+.+
T Consensus       352 ~~~~GKrvvlVDDSIVRGtTs~~IVkmlrea  382 (474)
T KOG0572|consen  352 QNFEGKRVVLVDDSIVRGTTSSPIVKMLREA  382 (474)
T ss_pred             hhcCCceEEEEecceeccCchHHHHHHHHHc
Confidence            4466999999999999964 55678888754


No 61 
>PF12710 HAD:  haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B.
Probab=24.94  E-value=50  Score=25.33  Aligned_cols=13  Identities=31%  Similarity=0.491  Sum_probs=11.4

Q ss_pred             cCCcEEEEecchh
Q 030408          115 RNKNIGFVGDSLN  127 (178)
Q Consensus       115 rgk~i~FVGDSl~  127 (178)
                      ..+++++||||.+
T Consensus       174 ~~~~~~~iGDs~~  186 (192)
T PF12710_consen  174 DPDRVIAIGDSIN  186 (192)
T ss_dssp             TCCEEEEEESSGG
T ss_pred             CCCeEEEEECCHH
Confidence            4789999999986


No 62 
>PF14647 FAM91_N:  FAM91 N-terminus
Probab=24.77  E-value=81  Score=28.58  Aligned_cols=31  Identities=19%  Similarity=0.393  Sum_probs=25.6

Q ss_pred             CCCCCChHHHHHHhcCCcEEEEecchhhHHHHHHHHhhhhc
Q 030408          101 DLPQIDPVKFLSLMRNKNIGFVGDSLNENFIVSFLCVLRAA  141 (178)
Q Consensus       101 ~lp~fd~~~fl~~lrgk~i~FVGDSl~Rn~~~SL~clL~~~  141 (178)
                      .||.|+++|.++++-          ++||||-.++.-.++.
T Consensus       108 sLPNFTAaD~LRllG----------IGRNqYIdlmn~~RS~  138 (308)
T PF14647_consen  108 SLPNFTAADCLRLLG----------IGRNQYIDLMNKCRSK  138 (308)
T ss_pred             cCCCCcHHHHHHHhc----------chHHHHHHHHHHhchh
Confidence            389999999997763          6799999999876654


No 63 
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=24.62  E-value=64  Score=26.18  Aligned_cols=35  Identities=17%  Similarity=0.154  Sum_probs=25.3

Q ss_pred             CChHHHHHHhcCCcEEEEecchhhHHHHHHHHhhhhc
Q 030408          105 IDPVKFLSLMRNKNIGFVGDSLNENFIVSFLCVLRAA  141 (178)
Q Consensus       105 fd~~~fl~~lrgk~i~FVGDSl~Rn~~~SL~clL~~~  141 (178)
                      -.-.++.+.++||.++|+|-|=.--  -||+..|...
T Consensus        24 ~g~~~l~~~l~~k~~vl~G~SGvGK--SSLiN~L~~~   58 (161)
T PF03193_consen   24 EGIEELKELLKGKTSVLLGQSGVGK--SSLINALLPE   58 (161)
T ss_dssp             TTHHHHHHHHTTSEEEEECSTTSSH--HHHHHHHHTS
T ss_pred             cCHHHHHHHhcCCEEEEECCCCCCH--HHHHHHHHhh
Confidence            3457888999999999999885543  2556655543


No 64 
>PF13289 SIR2_2:  SIR2-like domain
Probab=23.83  E-value=1.6e+02  Score=21.58  Aligned_cols=33  Identities=30%  Similarity=0.322  Sum_probs=23.9

Q ss_pred             HHHHHHhcCCcEEEEecchhhHHHHHHHHhhhh
Q 030408          108 VKFLSLMRNKNIGFVGDSLNENFIVSFLCVLRA  140 (178)
Q Consensus       108 ~~fl~~lrgk~i~FVGDSl~Rn~~~SL~clL~~  140 (178)
                      ..+.+.++.+.++|||=|+.-..+..++.-+..
T Consensus        78 ~~l~~~l~~~~~lfiGys~~D~~i~~~l~~~~~  110 (143)
T PF13289_consen   78 NFLRSLLRSKTLLFIGYSFNDPDIRQLLRSALE  110 (143)
T ss_pred             HHHHHHHcCCCEEEEEECCCCHHHHHHHHHHHH
Confidence            345577889999999988876666666654443


No 65 
>PLN02954 phosphoserine phosphatase
Probab=23.82  E-value=67  Score=25.68  Aligned_cols=14  Identities=21%  Similarity=0.404  Sum_probs=11.1

Q ss_pred             CCcEEEEecchhhH
Q 030408          116 NKNIGFVGDSLNEN  129 (178)
Q Consensus       116 gk~i~FVGDSl~Rn  129 (178)
                      -+++++||||.+=-
T Consensus       169 ~~~~i~iGDs~~Di  182 (224)
T PLN02954        169 YKTMVMIGDGATDL  182 (224)
T ss_pred             CCceEEEeCCHHHH
Confidence            36899999998743


No 66 
>CHL00073 chlN photochlorophyllide reductase subunit N
Probab=23.43  E-value=99  Score=29.23  Aligned_cols=27  Identities=37%  Similarity=0.642  Sum_probs=17.7

Q ss_pred             HHHHhcCCcEEEEecchhhHHHHHHHHhhh
Q 030408          110 FLSLMRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       110 fl~~lrgk~i~FVGDSl~Rn~~~SL~clL~  139 (178)
                      ..+.++|||++++||+-   +-.+|+..|.
T Consensus       308 ~~~~L~GKrvai~Gdp~---~~i~LarfL~  334 (457)
T CHL00073        308 YLDLVRGKSVFFMGDNL---LEISLARFLI  334 (457)
T ss_pred             HHHHHCCCEEEEECCCc---HHHHHHHHHH
Confidence            44558899999999953   3344444444


No 67 
>PRK02255 putrescine carbamoyltransferase; Provisional
Probab=23.39  E-value=69  Score=28.88  Aligned_cols=24  Identities=25%  Similarity=0.522  Sum_probs=19.9

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhh
Q 030408          114 MRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       114 lrgk~i~FVGDSl~Rn~~~SL~clL~  139 (178)
                      +.|++|++|||- + |...|++.++.
T Consensus       152 l~glkv~~vGD~-~-~v~~Sl~~~~~  175 (338)
T PRK02255        152 LEDCKVVFVGDA-T-QVCVSLMFIAT  175 (338)
T ss_pred             CCCCEEEEECCC-c-hHHHHHHHHHH
Confidence            678999999995 3 68889888776


No 68 
>PF13419 HAD_2:  Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A ....
Probab=23.13  E-value=81  Score=23.14  Aligned_cols=16  Identities=38%  Similarity=0.445  Sum_probs=12.5

Q ss_pred             cCCcEEEEecchhhHHH
Q 030408          115 RNKNIGFVGDSLNENFI  131 (178)
Q Consensus       115 rgk~i~FVGDSl~Rn~~  131 (178)
                      ..+.++||||+. .+.-
T Consensus       149 ~p~~~~~vgD~~-~d~~  164 (176)
T PF13419_consen  149 PPEEILFVGDSP-SDVE  164 (176)
T ss_dssp             SGGGEEEEESSH-HHHH
T ss_pred             CcceEEEEeCCH-HHHH
Confidence            467899999998 5543


No 69 
>PRK10113 cell division modulator; Provisional
Probab=22.35  E-value=44  Score=24.18  Aligned_cols=17  Identities=35%  Similarity=0.751  Sum_probs=12.6

Q ss_pred             HhcCCcEEEE--ecchhhH
Q 030408          113 LMRNKNIGFV--GDSLNEN  129 (178)
Q Consensus       113 ~lrgk~i~FV--GDSl~Rn  129 (178)
                      .||||-++||  |||.-|.
T Consensus        38 ~LrGKYVAFvl~ge~FrRS   56 (80)
T PRK10113         38 MLRGKYVAFVLMGESFLRS   56 (80)
T ss_pred             eeccceEEEEEechhhccC
Confidence            5899999987  6665543


No 70 
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional
Probab=21.95  E-value=53  Score=29.27  Aligned_cols=27  Identities=15%  Similarity=0.113  Sum_probs=20.3

Q ss_pred             HhcCCcEEEEecchhhHHHHHHHHhhh
Q 030408          113 LMRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       113 ~lrgk~i~FVGDSl~Rn~~~SL~clL~  139 (178)
                      .+.|.+|++|||-..-|...|++-++.
T Consensus       154 ~l~g~~va~vGD~~~~rv~~Sl~~~~a  180 (310)
T PRK13814        154 HWNKLCVTIIGDIRHSRVANSLMDGLV  180 (310)
T ss_pred             CcCCcEEEEECCCCCCcHHHHHHHHHH
Confidence            467999999999764466777766655


No 71 
>PF09084 NMT1:  NMT1/THI5 like;  InterPro: IPR015168 This entry is found in the NMT1 and THI5 proteins. These proteins are proposed to be required for the biosynthesis of the pyrimidine moiety of thiamine [, , ]. They are regulated by thiamine []. ; PDB: 2X26_A 3E4R_A 3KSJ_A 3KSX_A 3UIF_A 4DDD_A 1US4_A 1US5_A 3IX1_B 2X7P_A ....
Probab=21.61  E-value=69  Score=25.17  Aligned_cols=26  Identities=27%  Similarity=0.371  Sum_probs=20.3

Q ss_pred             HHHhcCCcEEEEecchhhHHHHHHHH
Q 030408          111 LSLMRNKNIGFVGDSLNENFIVSFLC  136 (178)
Q Consensus       111 l~~lrgk~i~FVGDSl~Rn~~~SL~c  136 (178)
                      .+-|+||+|++.+.|.+...+..++.
T Consensus        88 ~~DLkGK~i~v~~~s~~~~~~~~~l~  113 (216)
T PF09084_consen   88 PADLKGKKIGVSRGSSSEYFLRALLK  113 (216)
T ss_dssp             GGGGTTSEEEESTTSHHHHHHHHHHH
T ss_pred             HHHhCCCEEEEecCcchhHHHHHHHH
Confidence            34579999999998887777776654


No 72 
>PHA02597 30.2 hypothetical protein; Provisional
Probab=20.54  E-value=73  Score=25.04  Aligned_cols=23  Identities=17%  Similarity=0.296  Sum_probs=15.7

Q ss_pred             ChHHHHHHhcC---CcEEEEecchhh
Q 030408          106 DPVKFLSLMRN---KNIGFVGDSLNE  128 (178)
Q Consensus       106 d~~~fl~~lrg---k~i~FVGDSl~R  128 (178)
                      +|.-++.+++.   ..++|||||..=
T Consensus       132 kp~~~~~a~~~~~~~~~v~vgDs~~d  157 (197)
T PHA02597        132 KEKLFIKAKEKYGDRVVCFVDDLAHN  157 (197)
T ss_pred             cHHHHHHHHHHhCCCcEEEeCCCHHH
Confidence            36666666553   348899999765


No 73 
>COG5275 BRCT domain type II [General function prediction only]
Probab=20.13  E-value=73  Score=28.00  Aligned_cols=30  Identities=20%  Similarity=0.259  Sum_probs=25.9

Q ss_pred             HHHhcCCcEEEEecc--hhhHHHHHHHHhhhh
Q 030408          111 LSLMRNKNIGFVGDS--LNENFIVSFLCVLRA  140 (178)
Q Consensus       111 l~~lrgk~i~FVGDS--l~Rn~~~SL~clL~~  140 (178)
                      .+||.|+.++|-||-  |.|+--..|+..+-.
T Consensus       154 ~~cL~G~~fVfTG~l~TlsR~~a~~lvk~yGg  185 (276)
T COG5275         154 RECLKGKVFVFTGDLKTLSRDDAKTLVKVYGG  185 (276)
T ss_pred             cccccccEEEEecccccccchhHHHHHHHhCC
Confidence            479999999999996  789999998887764


No 74 
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional
Probab=20.08  E-value=79  Score=30.47  Aligned_cols=26  Identities=27%  Similarity=0.240  Sum_probs=18.3

Q ss_pred             hcCCcEEEEecchhhHHHHHHHHhhh
Q 030408          114 MRNKNIGFVGDSLNENFIVSFLCVLR  139 (178)
Q Consensus       114 lrgk~i~FVGDSl~Rn~~~SL~clL~  139 (178)
                      ++|++|++|||-..-+...|++..+.
T Consensus       172 l~glkVa~vGD~~~~rva~Sl~~~l~  197 (525)
T PRK13376        172 NSFIHIALVGDLLHGRTVHSKVNGLK  197 (525)
T ss_pred             cCCCEEEEECCCCCCcHHHHHHHHHH
Confidence            57899999999754455556665544


Done!