Citrus Sinensis ID: 030414


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MDPRLCNGEYFHLILFSSFVILQLIMILIFFQTVEEEVYEAHKNELEPTLAKRAEHYFTENRRVAKGLEAWKSGNSQDFGKLISASGLSSIYNYECGSEPLIQLNEILQRAPGVFGARFSGAGFRGCCLALVDADRAEEAASYVRSEYFELQPELASQLNADSAVLICKPGDCARVI
cccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccHHHHEEccccHHHHHHHHHHHHHHHcHHHHHHcccccEEEEEEcccccccc
*DPRLCNGEYFHLILFSSFVILQLIMILIFFQTVEEEVYEAHKNELEPTLAKRAEHYFTENRRVAKGLEAWKSGNSQDFGKLISASGLSSIYNYECGSEPLIQLNEILQRAPGVFGARFSGAGFRGCCLALVDADRAEEAASYVRSEYFELQPELASQLNADSAVLICKPGDCARVI
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPRLCNGEYFHLILFSSFVILQLIMILIFFQTVEEEVYEAHKNELEPTLAKRAEHYFTENRRVAKGLEAWKSGNSQDFGKLISASGLSSIYNYECGSEPLIQLNEILQRAPGVFGARFSGAGFRGCCLALVDADRAEEAASYVRSEYFELQPELASQLNADSAVLICKPGDCARVI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Galacturonokinase Sugar-1-kinase with a strict substrate specificity for the alpha-anomeric configuration of D-galacturonic acid (D-GalA) and ATP. Involved in the biosynthesis of UDP-galacturonic acid (UDP-GalA) from the salvaged GalA that is released during growth-dependent cell wall restructuring.probableQ8VYG2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WUU, chain A
Confidence level:very confident
Coverage over the Query: 10-148,160-177
View the alignment between query and template
View the model in PyMOL