Citrus Sinensis ID: 030421

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------

MAFQESPQLNQPPKESMPKERQNPSVPRASRSNVQEMRQVFDKFDTNKDGKISQDEYNSALSVLGKGISKAEMAKSFRFIDTDKDGYIDFKEFIEMMHDMGDNRVKKNDIQGAFQLFDLNGDKKISAEELMEVLRKMGEKYSLDSCRKMIRGVDADGDGLIDMDEFMTMMTRNVKVA

ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHcc

***********************************EMRQVFDKFDTNKDGKISQDEYNSALSVLGKGISKAEMAKSFRFIDTDKDGYIDFKEFIEMMHDMGDNRVKKNDIQGAFQLFDLNGDKKISAEELMEVLRKMGEKYSLDSCRKMIRGVDADGDGLIDMDEFMTMMTRNV***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAFQESPQLNQPPKESMPKERQNPSVPRASRSNVQEMRQVFDKFDTNKDGKISQDEYNSALSVLGKGISKAEMAKSFRFIDTDKDGYIDFKEFIEMMHDMGDNRVKKNDIQGAFQLFDLNGDKKISAEELMEVLRKMGEKYSLDSCRKMIRGVDADGDGLIDMDEFMTMMTRNVKVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Calmodulin	Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases.	probable	P24044
Calmodulin	Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases (By similarity). Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis.	probable	Q5RAD2
Calmodulin-like protein 1	Potential calcium sensor.	probable	Q9ZQE6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DTL, chain A
Confidence level:very confident
Coverage over the Query: 25-172
View the alignment between query and template
View the model in PyMOL