BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030450
         (177 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3BBO|O Chain O, Homology Model For The Spinach Chloroplast 50s Subunit
           Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
          Length = 135

 Score = 27.7 bits (60), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 95  GSGSPSFAIAVVLACIVMYDASGV 118
           G GSP + +AVV    ++Y+ SGV
Sbjct: 86  GKGSPEYWVAVVKPGRILYEISGV 109


>pdb|3KOW|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase Backsoaked
           Complex
 pdb|3KOW|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase Backsoaked
           Complex
 pdb|3KOW|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase Backsoaked
           Complex
 pdb|3KOW|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase Backsoaked
           Complex
 pdb|3KOX|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With 2,4- Diaminobutyrate (Anaerobic)
 pdb|3KOX|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With 2,4- Diaminobutyrate (Anaerobic)
 pdb|3KOX|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With 2,4- Diaminobutyrate (Anaerobic)
 pdb|3KOX|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With 2,4- Diaminobutyrate (Anaerobic)
 pdb|3KOY|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With Ornithine (Aerobic)
 pdb|3KOY|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With Ornithine (Aerobic)
 pdb|3KOY|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With Ornithine (Aerobic)
 pdb|3KOY|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With Ornithine (Aerobic)
 pdb|3KOZ|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With Ornithine (Anaerobic)
 pdb|3KOZ|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With Ornithine (Anaerobic)
 pdb|3KOZ|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With Ornithine (Anaerobic)
 pdb|3KOZ|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With Ornithine (Anaerobic)
 pdb|3KP0|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With 2,4- Diaminobutyrate (Dab) (Aerobic)
 pdb|3KP0|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With 2,4- Diaminobutyrate (Dab) (Aerobic)
 pdb|3KP0|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With 2,4- Diaminobutyrate (Dab) (Aerobic)
 pdb|3KP0|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
           With 2,4- Diaminobutyrate (Dab) (Aerobic)
 pdb|3KP1|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase (Resting
           State)
 pdb|3KP1|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase (Resting
           State)
 pdb|3KP1|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase (Resting
           State)
 pdb|3KP1|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase (Resting
           State)
          Length = 763

 Score = 26.9 bits (58), Expect = 5.6,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 5/57 (8%)

Query: 111 VMYDASGVRLHAGRQAEL---LNQIVCEFPPDHPLSSVRPLRELLGHTPLQVVAGGI 164
           VM +A G R+    +      +N +V   PP+  + S   +RE +  TPL++VA  +
Sbjct: 556 VMQEAEGTRIELKGRVPFSIDINSLV--IPPEPEILSEDEIREDIEKTPLKIVAATV 610


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.133    0.395 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,114,452
Number of Sequences: 62578
Number of extensions: 131334
Number of successful extensions: 316
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 314
Number of HSP's gapped (non-prelim): 3
length of query: 177
length of database: 14,973,337
effective HSP length: 92
effective length of query: 85
effective length of database: 9,216,161
effective search space: 783373685
effective search space used: 783373685
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)