BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 030450
(177 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3BBO|O Chain O, Homology Model For The Spinach Chloroplast 50s Subunit
Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
Length = 135
Score = 27.7 bits (60), Expect = 3.8, Method: Compositional matrix adjust.
Identities = 11/24 (45%), Positives = 16/24 (66%)
Query: 95 GSGSPSFAIAVVLACIVMYDASGV 118
G GSP + +AVV ++Y+ SGV
Sbjct: 86 GKGSPEYWVAVVKPGRILYEISGV 109
>pdb|3KOW|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase Backsoaked
Complex
pdb|3KOW|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase Backsoaked
Complex
pdb|3KOW|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase Backsoaked
Complex
pdb|3KOW|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase Backsoaked
Complex
pdb|3KOX|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With 2,4- Diaminobutyrate (Anaerobic)
pdb|3KOX|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With 2,4- Diaminobutyrate (Anaerobic)
pdb|3KOX|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With 2,4- Diaminobutyrate (Anaerobic)
pdb|3KOX|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With 2,4- Diaminobutyrate (Anaerobic)
pdb|3KOY|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With Ornithine (Aerobic)
pdb|3KOY|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With Ornithine (Aerobic)
pdb|3KOY|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With Ornithine (Aerobic)
pdb|3KOY|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With Ornithine (Aerobic)
pdb|3KOZ|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With Ornithine (Anaerobic)
pdb|3KOZ|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With Ornithine (Anaerobic)
pdb|3KOZ|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With Ornithine (Anaerobic)
pdb|3KOZ|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With Ornithine (Anaerobic)
pdb|3KP0|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With 2,4- Diaminobutyrate (Dab) (Aerobic)
pdb|3KP0|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With 2,4- Diaminobutyrate (Dab) (Aerobic)
pdb|3KP0|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With 2,4- Diaminobutyrate (Dab) (Aerobic)
pdb|3KP0|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase In Complex
With 2,4- Diaminobutyrate (Dab) (Aerobic)
pdb|3KP1|A Chain A, Crystal Structure Of Ornithine 4,5 Aminomutase (Resting
State)
pdb|3KP1|B Chain B, Crystal Structure Of Ornithine 4,5 Aminomutase (Resting
State)
pdb|3KP1|D Chain D, Crystal Structure Of Ornithine 4,5 Aminomutase (Resting
State)
pdb|3KP1|C Chain C, Crystal Structure Of Ornithine 4,5 Aminomutase (Resting
State)
Length = 763
Score = 26.9 bits (58), Expect = 5.6, Method: Composition-based stats.
Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 5/57 (8%)
Query: 111 VMYDASGVRLHAGRQAEL---LNQIVCEFPPDHPLSSVRPLRELLGHTPLQVVAGGI 164
VM +A G R+ + +N +V PP+ + S +RE + TPL++VA +
Sbjct: 556 VMQEAEGTRIELKGRVPFSIDINSLV--IPPEPEILSEDEIREDIEKTPLKIVAATV 610
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.133 0.395
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,114,452
Number of Sequences: 62578
Number of extensions: 131334
Number of successful extensions: 316
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 314
Number of HSP's gapped (non-prelim): 3
length of query: 177
length of database: 14,973,337
effective HSP length: 92
effective length of query: 85
effective length of database: 9,216,161
effective search space: 783373685
effective search space used: 783373685
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)