Query         030452
Match_columns 177
No_of_seqs    163 out of 976
Neff          5.3 
Searched_HMMs 29240
Date          Mon Mar 25 22:41:54 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030452.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/030452hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3mhs_C SAGA-associated factor   27.7      25 0.00086   25.6   1.6   49   16-65     28-77  (99)
  2 1r94_A Protein YFHF; tetrameri  11.1      61  0.0021   23.2   0.3   19   48-68     87-105 (118)
  3 1s6w_A Hepcidin; two strand an  10.7      48  0.0016   18.5  -0.3    8   63-70     14-21  (26)
  4 1m4f_A Hepcidin; strand-loop-s  10.3      46  0.0016   18.5  -0.4    8   63-70     18-25  (26)
  5 1x0g_A ISCA; [2Fe-2S], biosynt   8.9      56  0.0019   23.1  -0.6    8   58-67     99-106 (112)
  6 1nwb_A Hypothetical protein AQ   8.7      68  0.0023   23.2  -0.2   19   48-68     95-113 (124)
  7 2d2a_A SUFA protein; iron-sulf   7.9      87   0.003   23.6   0.1   18   47-66    124-141 (145)
  8 2hm3_A Nematocyst outer WALL a   7.7 1.1E+02  0.0038   17.3   0.4    9   59-67      7-16  (31)
  9 1iqz_A Ferredoxin; iron-sulfer   6.8      96  0.0033   19.8  -0.1   14   57-71      8-21  (81)
 10 2lg4_A Aurelin; antimicrobial    9.4   1E+02  0.0035   18.8   0.0   14   54-67     27-40  (40)

No 1  
>3mhs_C SAGA-associated factor 11; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3m99_B 3mhh_C 4fjc_C 4fk5_C 4fip_C 2lo2_A 3kjl_E 3kik_E
Probab=27.75  E-value=25  Score=25.57  Aligned_cols=49  Identities=16%  Similarity=0.335  Sum_probs=32.8

Q ss_pred             hhhccchhhhhhcCCCCcccCCCCCCccccccccccc-ccCCCCCchhhhh
Q 030452           16 AAQQRPQRRAKKLKKPNTKQNNKNSTSTSSSVGFGIE-KMEPLWRCVQGCG   65 (177)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gf~~~-~~~~~f~C~~~CG   65 (177)
                      .++.+-+.++-..+.|+.+.|.-...+..+..|-... .....|.|. .||
T Consensus        28 v~~e~~~~k~l~~r~p~~k~y~~~~~~~lDIfG~~~~~~~s~~~~C~-nC~   77 (99)
T 3mhs_C           28 VARETTQQQLLKTRYPDLRSYYFDPNGSLDINGLQKQQESSQYIHCE-NCG   77 (99)
T ss_dssp             HHHHHHHHHHHHHHCTTCCCCCCCTTSCSCTTSCCCCCTTSCEEECT-TTC
T ss_pred             HHHHHHHHHHHhccCCCCCCceecCCCCcccCCCcCcccCCCeEECC-CCC
Confidence            4444555556677778888777777777777776555 556677885 765


No 2  
>1r94_A Protein YFHF; tetrameric, beta barrel, iron-sulfur cluster protein, pseudo-symmetric motifs, metal transport; 2.30A {Escherichia coli} SCOP: b.124.1.1 PDB: 1r95_A 1s98_A
Probab=11.12  E-value=61  Score=23.25  Aligned_cols=19  Identities=32%  Similarity=0.693  Sum_probs=4.2

Q ss_pred             cccccccCCCCCchhhhhhhc
Q 030452           48 GFGIEKMEPLWRCVQGCGACC   68 (177)
Q Consensus        48 gf~~~~~~~~f~C~~~CG~CC   68 (177)
                      ||.-..-...-.|  +||.--
T Consensus        87 gF~~~NPna~~~C--gCG~SF  105 (118)
T 1r94_A           87 GFKFTNPNVKDEC--GCGESF  105 (118)
T ss_dssp             EEEEECTTCCC----------
T ss_pred             ceEEeCCCCCCCC--CCCCCc
Confidence            4433332333568  677644


No 3  
>1s6w_A Hepcidin; two strand antiparalell beta sheet, antibiotic; NMR {Synthetic} SCOP: j.3.1.8
Probab=10.67  E-value=48  Score=18.48  Aligned_cols=8  Identities=63%  Similarity=2.182  Sum_probs=6.7

Q ss_pred             hhhhhcCC
Q 030452           63 GCGACCKL   70 (177)
Q Consensus        63 ~CG~CC~~   70 (177)
                      +||.||+.
T Consensus        14 gCG~CC~f   21 (26)
T 1s6w_A           14 GCGVCCRF   21 (26)
T ss_dssp             SCEEECCC
T ss_pred             eecCcccc
Confidence            59999985


No 4  
>1m4f_A Hepcidin; strand-loop-strand, beta-sheet, hairpin loop, antimicrobial protein; NMR {Synthetic} SCOP: j.3.1.8 PDB: 2kef_A 3h0t_C
Probab=10.27  E-value=46  Score=18.53  Aligned_cols=8  Identities=63%  Similarity=1.713  Sum_probs=6.3

Q ss_pred             hhhhhcCC
Q 030452           63 GCGACCKL   70 (177)
Q Consensus        63 ~CG~CC~~   70 (177)
                      +||.||+.
T Consensus        18 ~CG~cC~~   25 (26)
T 1m4f_A           18 KCGMCCKT   25 (26)
T ss_dssp             SEEEECCC
T ss_pred             CcCCeeCC
Confidence            78888873


No 5  
>1x0g_A ISCA; [2Fe-2S], biosynthesis, cyanobacteria, domain swapping, Fe- S cluster, iron, iron-sulfur cluster protein, scaffold, sulfur; 2.50A {Thermosynechococcus elongatus}
Probab=8.92  E-value=56  Score=23.10  Aligned_cols=8  Identities=50%  Similarity=1.377  Sum_probs=4.9

Q ss_pred             CCchhhhhhh
Q 030452           58 WRCVQGCGAC   67 (177)
Q Consensus        58 f~C~~~CG~C   67 (177)
                      -.|  +||.-
T Consensus        99 ~~C--gCG~S  106 (112)
T 1x0g_A           99 QTC--GCGMA  106 (112)
T ss_dssp             EEC--SSSSE
T ss_pred             cCC--CCCCc
Confidence            467  67654


No 6  
>1nwb_A Hypothetical protein AQ_1857; QR6, structural genomics, protein structure initiative, NESG, reduced dimensionality PSI; NMR {Aquifex aeolicus} SCOP: b.124.1.1
Probab=8.74  E-value=68  Score=23.23  Aligned_cols=19  Identities=37%  Similarity=0.835  Sum_probs=2.8

Q ss_pred             cccccccCCCCCchhhhhhhc
Q 030452           48 GFGIEKMEPLWRCVQGCGACC   68 (177)
Q Consensus        48 gf~~~~~~~~f~C~~~CG~CC   68 (177)
                      ||.-......-.|  +||.--
T Consensus        95 gF~~~NPna~~~C--gCG~SF  113 (124)
T 1nwb_A           95 GFTIRNPNATGSC--GCGSSF  113 (124)
T ss_dssp             EEEEECC--------------
T ss_pred             eEEEeCCCCCcCC--CCCCCc
Confidence            5533333333567  676543


No 7  
>2d2a_A SUFA protein; iron-sulfur cluster, iron, ISCA, YADR, metal transport; 2.70A {Escherichia coli}
Probab=7.95  E-value=87  Score=23.58  Aligned_cols=18  Identities=28%  Similarity=0.604  Sum_probs=9.4

Q ss_pred             ccccccccCCCCCchhhhhh
Q 030452           47 VGFGIEKMEPLWRCVQGCGA   66 (177)
Q Consensus        47 ~gf~~~~~~~~f~C~~~CG~   66 (177)
                      .||.-......-.|  +||.
T Consensus       124 ~gF~f~NPna~~~C--GCG~  141 (145)
T 2d2a_A          124 QIFKFHNPKAQNEC--GCGE  141 (145)
T ss_dssp             EEEEEECTTTCSCC--CCBC
T ss_pred             ceEEEeCCCCCccc--CCCC
Confidence            35544333334568  7775


No 8  
>2hm3_A Nematocyst outer WALL antigen; disulfide, evolution, cysteine rich, structural protein; NMR {Hydra vulgaris} PDB: 2hm4_A 2hm5_A 2hm6_A
Probab=7.67  E-value=1.1e+02  Score=17.29  Aligned_cols=9  Identities=56%  Similarity=1.686  Sum_probs=5.5

Q ss_pred             Cchhhh-hhh
Q 030452           59 RCVQGC-GAC   67 (177)
Q Consensus        59 ~C~~~C-G~C   67 (177)
                      .|+.+| |.|
T Consensus         7 tcpsgcsgdc   16 (31)
T 2hm3_A            7 TCPSGCSGDC   16 (31)
T ss_dssp             CCCTTCCGGG
T ss_pred             cCCCCcCccc
Confidence            566666 555


No 9  
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A*
Probab=6.85  E-value=96  Score=19.79  Aligned_cols=14  Identities=36%  Similarity=0.871  Sum_probs=9.7

Q ss_pred             CCCchhhhhhhcCCC
Q 030452           57 LWRCVQGCGACCKLD   71 (177)
Q Consensus        57 ~f~C~~~CG~CC~~~   71 (177)
                      .-.|. +||.|=..-
T Consensus         8 ~~~Ci-gCg~C~~~C   21 (81)
T 1iqz_A            8 KETCI-ACGACGAAA   21 (81)
T ss_dssp             TTTCC-CCSHHHHHC
T ss_pred             cccCc-ccChhhHhC
Confidence            34795 999986643


No 10 
>2lg4_A Aurelin; antimicrobial protein; NMR {Aurelia aurita}
Probab=9.38  E-value=1e+02  Score=18.81  Aligned_cols=14  Identities=29%  Similarity=0.800  Sum_probs=10.6

Q ss_pred             cCCCCCchhhhhhh
Q 030452           54 MEPLWRCVQGCGAC   67 (177)
Q Consensus        54 ~~~~f~C~~~CG~C   67 (177)
                      ...+..|.+.||.|
T Consensus        27 ~~~r~~C~kTCG~C   40 (40)
T 2lg4_A           27 VKLRANCKKTCGLC   40 (40)
Confidence            34567898899987


Done!