Query         030454
Match_columns 177
No_of_seqs    162 out of 744
Neff          4.7 
Searched_HMMs 46136
Date          Fri Mar 29 13:58:24 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030454.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030454hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05922 Inhibitor_I9:  Peptida  99.5 3.5E-14 7.7E-19   99.2   5.7   78   83-164     1-82  (82)
  2 KOG0723 Molecular chaperone (D  28.1      21 0.00045   28.0   0.1   41  132-174    47-94  (112)
  3 PF03927 NapD:  NapD protein;    22.7      76  0.0016   22.7   2.2   17  141-157    55-71  (79)
  4 PRK10553 assembly protein for   19.4      88  0.0019   23.1   2.0   16  141-156    58-73  (87)
  5 PF03352 Adenine_glyco:  Methyl  17.3      27 0.00059   29.1  -1.2   29  125-153    49-81  (179)
  6 PF11080 DUF2622:  Protein of u  17.3 3.6E+02  0.0079   20.5   5.0   68   78-148     3-70  (96)
  7 PF01037 AsnC_trans_reg:  AsnC   16.8 1.5E+02  0.0033   19.3   2.6   17  140-156    13-29  (74)
  8 cd04901 ACT_3PGDH C-terminal A  16.7 1.4E+02  0.0031   19.1   2.4   19  138-156    49-67  (69)
  9 cd00408 DHDPS-like Dihydrodipi  16.5   6E+02   0.013   21.3   6.8   51   97-156   107-157 (281)
 10 TIGR00624 tag DNA-3-methyladen  16.4      43 0.00094   27.9  -0.2   29  125-153    53-85  (179)

No 1  
>PF05922 Inhibitor_I9:  Peptidase inhibitor I9;  InterPro: IPR010259 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  Limited proteolysis of most large protein precursors is carried out in vivo by the subtilisin-like pro-protein convertases. Many important biological processes such as peptide hormone synthesis, viral protein processing and receptor maturation involve proteolytic processing by these enzymes []. The subtilisin-serine protease (SRSP) family hormone and pro-protein convertases (furin, PC1/3, PC2, PC4, PACE4, PC5/6, and PC7/7/LPC) act within the secretory pathway to cleave polypeptide precursors at specific basic sites, generating their biologically active forms. Serum proteins, pro-hormones, receptors, zymogens, viral surface glycoproteins, bacterial toxins, amongst others, are activated by this route []. The SRSPs share the same domain structure, including a signal peptide, the pro-peptide, the catalytic domain, the P/middle or homo B domain, and the C terminus. Proteinase propeptide inhibitors (sometimes refered to as activation peptides) are responsible for the modulation of folding and activity of the pro-enzyme or zymogen. The pro-segment docks into the enzyme moiety shielding the substrate binding site, thereby promoting inhibition of the enzyme. Several such propeptides share a similar topology [], despite often low sequence identities []. The propeptide region has an open-sandwich antiparallel-alpha/antiparallel-beta fold, with two alpha-helices and four beta-strands with a (beta/alpha/beta)x2 topology. This group of sequences contain the propeptide domain at the N terminus of peptidases belonging to MEROPS family S8A, subtilisins. A number of the members of this group of sequences belong to MEROPS inhibitor family I9, clan I-. The propeptide is removed by proteolytic cleavage; removal activating the enzyme.; GO: 0004252 serine-type endopeptidase activity, 0042802 identical protein binding, 0043086 negative regulation of catalytic activity; PDB: 3CNQ_P 1SPB_P 3CO0_P 1ITP_A 1V5I_B 1SCJ_B 3P5B_P 2XTJ_P 2W2M_P 2P4E_P ....
Probab=99.50  E-value=3.5e-14  Score=99.21  Aligned_cols=78  Identities=21%  Similarity=0.336  Sum_probs=54.9

Q ss_pred             EEEEEecCCCCCCCchHHHHHHHHHHHHHhhCC----hhhhhcceeEEecCcceeeeeecCHHHHHHhhCCCCeEEEeCC
Q 030454           83 HWLIVMEFPNPSELSEEEMINAYVKTLAAVVGS----EEEAKKKIYSVCTTTYTGFGALIDEELSYKVKGQPGVLWVLPD  158 (177)
Q Consensus        83 tYIV~M~~~~~~~~~~~~~~~~h~s~LaSVlgS----~e~Ak~~IlYSYt~af~GFAA~LTeeEA~~Lk~~PGVlSVfPD  158 (177)
                      +|||.|+.+...    ....++|.+++.+++.+    .......++|+|+.+|+||+|+|+++++++|+++|+|.+|.||
T Consensus         1 ~YIV~~k~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~Gfs~~l~~~~i~~L~~~p~V~~Ve~D   76 (82)
T PF05922_consen    1 RYIVVFKDDASA----ASSFSSHKSWQASILKSALKSASSINAKVLYSYDNAFNGFSAKLSEEEIEKLRKDPGVKSVEPD   76 (82)
T ss_dssp             EEEEEE-TTSTH----HCHHHHHHHHHH----HHHHTH-TTT-EEEEEESSTSSEEEEEE-HHHHHHHHTSTTEEEEEEE
T ss_pred             CEEEEECCCCCc----chhHHHHHHHHHHHHhhhhhhhcccCCceEEEEeeeEEEEEEEeCHHHHHHHHcCCCeEEEEeC
Confidence            699999866432    22345555555544332    1234567999999999999999999999999999999999999


Q ss_pred             CCccCC
Q 030454          159 SYIDVP  164 (177)
Q Consensus       159 ~~~~L~  164 (177)
                      +.+++|
T Consensus        77 ~~v~l~   82 (82)
T PF05922_consen   77 QVVSLH   82 (82)
T ss_dssp             CEEEE-
T ss_pred             ceEecC
Confidence            988775


No 2  
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=28.09  E-value=21  Score=28.02  Aligned_cols=41  Identities=20%  Similarity=0.261  Sum_probs=28.8

Q ss_pred             eeeeeecCHHHHHHhhCCCCeEEEeCCCCcc-------CCCCCCCCcccc
Q 030454          132 TGFGALIDEELSYKVKGQPGVLWVLPDSYID-------VPNKDYGGRYFL  174 (177)
Q Consensus       132 ~GFAA~LTeeEA~~Lk~~PGVlSVfPD~~~~-------L~~k~yg~~~~~  174 (177)
                      -||..++|..||..+-+.-  -++-+++..+       ...+|-||-+|+
T Consensus        47 GGF~~kMsr~EA~lIL~v~--~s~~k~KikeaHrriM~~NHPD~GGSPYl   94 (112)
T KOG0723|consen   47 GGFEPKMSRREAALILGVT--PSLDKDKIKEAHRRIMLANHPDRGGSPYL   94 (112)
T ss_pred             cccccccchHHHHHHhCCC--ccccHHHHHHHHHHHHHcCCCcCCCCHHH
Confidence            4999999999999965544  2333343332       456899998886


No 3  
>PF03927 NapD:  NapD protein;  InterPro: IPR005623 This entry represents NapD, the twin-arginine signal-peptide-binding chaperone for NapA, functioning as an assembly protein for the periplasmic nitrate reductase NapABC. The periplasmic NapABC enzyme likely functions during growth in nitrate-limited environments [].; PDB: 2JSX_A 2PQ4_A.
Probab=22.69  E-value=76  Score=22.68  Aligned_cols=17  Identities=29%  Similarity=0.364  Sum_probs=13.3

Q ss_pred             HHHHHhhCCCCeEEEeC
Q 030454          141 ELSYKVKGQPGVLWVLP  157 (177)
Q Consensus       141 eEA~~Lk~~PGVlSVfP  157 (177)
                      +..++|+.+|||+++-.
T Consensus        55 ~~~~~i~~l~GVlsa~l   71 (79)
T PF03927_consen   55 DLIDAINALPGVLSASL   71 (79)
T ss_dssp             HHHHHHCCSTTEEEEEE
T ss_pred             HHHHHHHcCCCceEEEE
Confidence            44577889999999853


No 4  
>PRK10553 assembly protein for periplasmic nitrate reductase; Provisional
Probab=19.45  E-value=88  Score=23.08  Aligned_cols=16  Identities=31%  Similarity=0.256  Sum_probs=13.3

Q ss_pred             HHHHHhhCCCCeEEEe
Q 030454          141 ELSYKVKGQPGVLWVL  156 (177)
Q Consensus       141 eEA~~Lk~~PGVlSVf  156 (177)
                      +..+.|+.+|||+++-
T Consensus        58 ~~i~~I~~l~GVlsa~   73 (87)
T PRK10553         58 QTIESVRNVEGVLAVS   73 (87)
T ss_pred             HHHHHHHcCCCceEEE
Confidence            5567889999999984


No 5  
>PF03352 Adenine_glyco:  Methyladenine glycosylase;  InterPro: IPR005019  This family of methyladenine glycosylases includes DNA-3-methyladenine glycosylase I (3.2.2.20 from EC) which acts as a base excision repair enzyme by severing the glycosylic bond of numerous damaged bases. The enzyme is constitutively expressed and is specific for the alkylated 3-methyladenine DNA.; GO: 0008725 DNA-3-methyladenine glycosylase I activity, 0006284 base-excision repair; PDB: 2OFI_A 2OFK_A 2JG6_A 4AIA_E 4AI5_C 4AI4_A 1LMZ_A 1P7M_A 1NKU_A.
Probab=17.34  E-value=27  Score=29.08  Aligned_cols=29  Identities=28%  Similarity=0.558  Sum_probs=23.5

Q ss_pred             EEecCcceeee----eecCHHHHHHhhCCCCeE
Q 030454          125 SVCTTTYTGFG----ALIDEELSYKVKGQPGVL  153 (177)
Q Consensus       125 YSYt~af~GFA----A~LTeeEA~~Lk~~PGVl  153 (177)
                      -.|..+|.||-    |+++|++.++|..-|+++
T Consensus        49 ~~~r~aF~~Fd~~~vA~~~e~~ie~l~~d~~iI   81 (179)
T PF03352_consen   49 EAFREAFAGFDPEKVAKMDEEDIERLMQDPGII   81 (179)
T ss_dssp             HHHHHHTGGGHHHHHHT--HHHHHHHTTSTTSS
T ss_pred             HHHHHHHHCCCHHHHHcCCHHHHHHHhcCcchh
Confidence            35778999995    899999999999999976


No 6  
>PF11080 DUF2622:  Protein of unknown function (DUF2622);  InterPro: IPR022597  This family is conserved in the Enterobacteriaceae family. The function is not known. 
Probab=17.33  E-value=3.6e+02  Score=20.48  Aligned_cols=68  Identities=9%  Similarity=0.063  Sum_probs=39.4

Q ss_pred             CCCceEEEEEecCCCCCCCchHHHHHHHHHHHHHhhCChhhhhcceeEEecCcceeeeeecCHHHHHHhhC
Q 030454           78 GCDYQHWLIVMEFPNPSELSEEEMINAYVKTLAAVVGSEEEAKKKIYSVCTTTYTGFGALIDEELSYKVKG  148 (177)
Q Consensus        78 g~d~ktYIV~M~~~~~~~~~~~~~~~~h~s~LaSVlgS~e~Ak~~IlYSYt~af~GFAA~LTeeEA~~Lk~  148 (177)
                      ..+...|||.+.-....-   .+.-.-+..+-..-+...-....-+.|--.+.=+|+--.|+++|++.|.+
T Consensus         3 ~~~~~~YVVt~~~~e~~l---~d~~~L~~~lt~~GF~~tl~D~~G~~HeLgtntfgl~S~l~~~eV~~la~   70 (96)
T PF11080_consen    3 SSDITRYVVTFEYQEAGL---TDINELNNHLTRAGFSTTLTDEDGNPHELGTNTFGLISALSAEEVAQLAR   70 (96)
T ss_pred             CCcceEEEEEEEeccCCh---HHHHHHHHHHHhcCceeEEecCCCCEeecCCCeEEEEecCCHHHHHHHHH
Confidence            456789999998665421   12222222222211111101122367888888889999999999988764


No 7  
>PF01037 AsnC_trans_reg:  AsnC family;  InterPro: IPR019887 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities. One such family is the AsnC/Lrp subfamily []. The Lrp family of transcriptional regulators appears to be widely distributed among bacteria and archaea, as an important regulatory system of the amino acid metabolism and related processes [].  Members of the Lrp family are small DNA-binding proteins with molecular masses of around 15 kDa. Target promoters often contain a number of binding sites that typically lack obvious inverted repeat elements, and to which binding is usually co-operative. LrpA from Pyrococcus furiosus is the first Lrp-like protein to date of which a three-dimensional structure has been solved. In the crystal structure LrpA forms an octamer consisting of four dimers. The structure revealed that the N-terminal part of the protein consists of a helix-turn-helix (HTH) domain, a fold generally involved in DNA binding. The C terminus of Lrp-like proteins has a beta-fold, where the two alpha-helices are located at one side of the four-stranded antiparallel beta-sheet. LrpA forms a homodimer mainly through interactions between the beta-strands of this C-terminal domain, and an octamer through further interactions between the second alpha-helix and fourth beta-strand of the motif. Hence, the C-terminal domain of Lrp-like proteins appears to be involved in ligand-response and activation [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 2DJW_F 2GQQ_A 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2CG4_B 2DBB_B 1I1G_A ....
Probab=16.84  E-value=1.5e+02  Score=19.27  Aligned_cols=17  Identities=18%  Similarity=0.251  Sum_probs=13.3

Q ss_pred             HHHHHHhhCCCCeEEEe
Q 030454          140 EELSYKVKGQPGVLWVL  156 (177)
Q Consensus       140 eeEA~~Lk~~PGVlSVf  156 (177)
                      ++-+++|+++|+|..++
T Consensus        13 ~~~~~~l~~~p~V~~~~   29 (74)
T PF01037_consen   13 DEFAEALAEIPEVVECY   29 (74)
T ss_dssp             HHHHHHHHTSTTEEEEE
T ss_pred             HHHHHHHHcCCCEEEEE
Confidence            34568888999998876


No 8  
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria. The C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria. 3PGDH is an enzyme that belongs to the D-isomer specific, 2-hydroxyacid dehydrogenase family and catalyzes the oxidation of D-3-phosphoglycerate to 3- phosphohydroxypyruvate, which is the first step in the biosynthesis of L-serine, using NAD+ as the oxidizing agent. In Escherichia coli, the SerA 3PGDH is feedback-controlled by the end product L-serine in an allosteric manner. In the homotetrameric enzyme, the interface at adjacent ACT (regulatory) domains couples to create an extended beta-sheet. Each regulatory interface forms two serine-binding sites. The mechanism by which serine transmits inhibition to the active site is postulated to involve the tethering of the regulatory domains together to create a rigid quaternary structure with a solvent-
Probab=16.73  E-value=1.4e+02  Score=19.11  Aligned_cols=19  Identities=32%  Similarity=0.515  Sum_probs=16.3

Q ss_pred             cCHHHHHHhhCCCCeEEEe
Q 030454          138 IDEELSYKVKGQPGVLWVL  156 (177)
Q Consensus       138 LTeeEA~~Lk~~PGVlSVf  156 (177)
                      ..++-.++|+++|||..|.
T Consensus        49 ~l~~li~~l~~~~~V~~v~   67 (69)
T cd04901          49 VSEELLEALRAIPGTIRVR   67 (69)
T ss_pred             CCHHHHHHHHcCCCeEEEE
Confidence            5667789999999999885


No 9  
>cd00408 DHDPS-like Dihydrodipicolinate synthase family. A member of the class I aldolases, which use an active-site lysine which stablilzes a reaction intermediate via Schiff base formation, and have TIM beta/alpha barrel fold. The dihydrodipicolinate synthase family comprises several pyruvate-dependent class I aldolases that use the same catalytic step to catalyze different reactions in different pathways and includes such proteins as N-acetylneuraminate lyase, MosA protein, 5-keto-4-deoxy-glucarate dehydratase, trans-o-hydroxybenzylidenepyruvate hydratase-aldolase, trans-2'-carboxybenzalpyruvate hydratase-aldolase, and 2-keto-3-deoxy- gluconate aldolase. The family is also referred to as the N-acetylneuraminate lyase (NAL) family.
Probab=16.53  E-value=6e+02  Score=21.31  Aligned_cols=51  Identities=16%  Similarity=0.173  Sum_probs=31.9

Q ss_pred             chHHHHHHHHHHHHHhhCChhhhhcceeEEecCcceeeeeecCHHHHHHhhCCCCeEEEe
Q 030454           97 SEEEMINAYVKTLAAVVGSEEEAKKKIYSVCTTTYTGFGALIDEELSYKVKGQPGVLWVL  156 (177)
Q Consensus        97 ~~~~~~~~h~s~LaSVlgS~e~Ak~~IlYSYt~af~GFAA~LTeeEA~~Lk~~PGVlSVf  156 (177)
                      +.+++.+++......+      ..+-++|.+-. .+  ...|+.+...+|.+.|+|+.+-
T Consensus       107 ~~~~~~~~~~~ia~~~------~~pi~iYn~P~-~t--g~~l~~~~~~~L~~~~~v~giK  157 (281)
T cd00408         107 SQEGIVAHFKAVADAS------DLPVILYNIPG-RT--GVDLSPETIARLAEHPNIVGIK  157 (281)
T ss_pred             CHHHHHHHHHHHHhcC------CCCEEEEECcc-cc--CCCCCHHHHHHHhcCCCEEEEE
Confidence            4455555554443321      13345665532 23  3589999999999999999875


No 10 
>TIGR00624 tag DNA-3-methyladenine glycosylase I. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=16.42  E-value=43  Score=27.93  Aligned_cols=29  Identities=14%  Similarity=0.305  Sum_probs=25.2

Q ss_pred             EEecCcceee----eeecCHHHHHHhhCCCCeE
Q 030454          125 SVCTTTYTGF----GALIDEELSYKVKGQPGVL  153 (177)
Q Consensus       125 YSYt~af~GF----AA~LTeeEA~~Lk~~PGVl  153 (177)
                      -.|..+|.||    .|.++|++.++|..-||++
T Consensus        53 ~~fr~aF~~Fd~~~VA~~~e~~ie~L~~d~~II   85 (179)
T TIGR00624        53 ENYRRAFSGFDIVKVARMTDADVERLLQDDGII   85 (179)
T ss_pred             HHHHHHHcCCCHHHHhCCCHHHHHHHhcCccch
Confidence            3577889999    4899999999999999976


Done!