Citrus Sinensis ID: 030480


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MARSMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPPPASSNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGSDATKGKELVAYMGPQPPTGIHRYVFALFNQKGKVMAGCRPPDARSNFSTRRFAADNGLQPPVAAVYFNSQKEVAVRKR
ccccccccHcccccccccccccccEEEEEEEccEEEcccccccccccccccEEEEccccccccccEEEEEEcccccccccccccEEEEEEEEccccccccccccEEEEcccccccccccEEEEEEEEcccccccccccccccccccHHHHHHHccccccEEEEEEEEEEccccccc
*A*SMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPPPASSNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGSDATKGKELVAYMGPQPPTGIHRYVFALFNQKGKVMAGC*P***RSNFSTRRFAADNGLQPPVAAVYFNSQKE******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARSMEPLVVGRVIGDVVDMFTPATEMTVHYGTKQVANGCEIKPSASADKPSVQIHAPPPASSNLYTLVMVDPDAPSPSEPRYREWLHWIVVDIPEGSDATKGKELVAYMGPQPPTGIHRYVFALFNQKGKVMAGCRPPDARSNFSTRRFAADNGLQPPVAAVYFNSQKEVAVRKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein MOTHER of FT and TF 1 May form complexes with phosphorylated ligands by interfering with kinases and their effectors.probableQ9XFK7
Phosphatidylethanolamine-binding protein 1 HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.probableQ3YIX4
Protein SELF-PRUNING Not known. In plants homozygous for the recessive allele of the SP gene, sympodial segments develop progressively fewer nodes until the shoot is terminated by two consecutive. inflorescences.probableO82088

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WKO, chain A
Confidence level:very confident
Coverage over the Query: 3-170
View the alignment between query and template
View the model in PyMOL