Citrus Sinensis ID: 030493


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MLIKECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSITFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCENNISPNIAGRPTEAMQLYDSMLRNGIMPDGLLLSTLADYNLQSSGSQEHCI
cccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccc
cccccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHccccHHHcc
MLIKECHLDAALKLFGQLtdrglepdiityNTIICGYCSLNRLDEAVQLFEKLTcvqlkpnsiTFTILIDAFCKEGRMDDATMMFSKMLekgpkanvvTYSCLIDGYFKSQNMKSAFDVYEEMCennispniagrptEAMQLYDSMLrngimpdglLLSTLAdynlqssgsqehci
MLIKECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTcvqlkpnsitFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCENNISPNIAGRPTEAMQLYDSMLRNGIMPDGLLLSTLADynlqssgsqehci
MLIKECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSITFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCENNISPNIAGRPTEAMQLYDSMLRNGIMPDGLLLSTLADYNLQSSGSQEHCI
**IKECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSITFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCENNISPNIAGRPTEAMQLYDSMLRNGIMPDGLLLSTLADY************
MLIKECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSITFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCENNISPNIAGRPTEAMQLYDSMLRNGIMPDGLLLSTLADYNLQSSGSQEHCI
MLIKECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSITFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCENNISPNIAGRPTEAMQLYDSMLRNGIMPDGLLLSTLADYNL**********
MLIKECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSITFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCENNISPNIAGRPTEAMQLYDSMLRNGIMPDGLLLSTLADYNLQSSGSQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIKECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSITFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCENNISPNIAGRPTEAMQLYDSMLRNGIMPDGLLLSTLADYNLQSSGSQEHCI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query176 2.2.26 [Sep-21-2011]
Q9C6S6840 Putative pentatricopeptid yes no 0.982 0.205 0.4 2e-37
Q9FIX3 747 Pentatricopeptide repeat- no no 0.892 0.210 0.319 9e-25
Q9SH26577 Pentatricopeptide repeat- no no 0.926 0.282 0.320 2e-24
Q0WVK7 741 Pentatricopeptide repeat- no no 0.909 0.215 0.354 2e-24
Q9LPX2 644 Pentatricopeptide repeat- no no 0.948 0.259 0.312 3e-24
Q9LQ16 632 Pentatricopeptide repeat- no no 0.869 0.242 0.327 1e-23
Q9CAN5 614 Pentatricopeptide repeat- no no 0.914 0.262 0.318 5e-23
Q9CAN0 630 Pentatricopeptide repeat- no no 0.869 0.242 0.321 7e-23
Q9SXD1 630 Pentatricopeptide repeat- no no 0.926 0.258 0.309 8e-23
O04491 607 Putative pentatricopeptid no no 0.909 0.263 0.308 1e-22
>sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containing protein At1g31840 OS=Arabidopsis thaliana GN=At1g31840 PE=2 SV=2 Back     alignment and function desciption
 Score =  155 bits (391), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 115/225 (51%), Gaps = 52/225 (23%)

Query: 2   LIKECH-LDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKP 60
           L+ +CH ++ A K F  L +  +EPDI+TYNT+ICGYCSL RLDEA ++FE L      P
Sbjct: 610 LLFKCHRIEDASKFFNNLIEGKMEPDIVTYNTMICGYCSLRRLDEAERIFELLKVTPFGP 669

Query: 61  NSITFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVY 120
           N++T TILI   CK   MD A  MFS M EKG K N VTY CL+D + KS +++ +F ++
Sbjct: 670 NTVTLTILIHVLCKNNDMDGAIRMFSIMAEKGSKPNAVTYGCLMDWFSKSVDIEGSFKLF 729

Query: 121 EEMCENNISPNI-----------------------------------------------A 133
           EEM E  ISP+I                                                
Sbjct: 730 EEMQEKGISPSIVSYSIIIDGLCKRGRVDEATNIFHQAIDAKLLPDVVAYAILIRGYCKV 789

Query: 134 GRPTEAMQLYDSMLRNGIMPDGLLLSTLADYN----LQSSGSQEH 174
           GR  EA  LY+ MLRNG+ PD LL   L++YN    L S G   H
Sbjct: 790 GRLVEAALLYEHMLRNGVKPDDLLQRALSEYNPPKWLMSKGVWVH 834





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 Back     alignment and function description
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function description
>sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 Back     alignment and function description
>sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=2 SV=2 Back     alignment and function description
>sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containing protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
224135613 854 predicted protein [Populus trichocarpa] 0.977 0.201 0.486 8e-51
296088470 822 unnamed protein product [Vitis vinifera] 0.977 0.209 0.452 8e-48
225427506 1131 PREDICTED: putative pentatricopeptide re 0.960 0.149 0.458 9e-48
240254191 840 pentatricopeptide (PPR) repeat-containin 0.982 0.205 0.4 8e-36
334182978 811 pentatricopeptide (PPR) repeat-containin 0.982 0.213 0.4 8e-36
449521772 645 PREDICTED: pentatricopeptide repeat-cont 0.869 0.237 0.406 9e-27
357499959 652 Pentatricopeptide repeat-containing prot 0.954 0.257 0.331 1e-26
357499975 590 Pentatricopeptide repeat-containing prot 0.954 0.284 0.331 3e-26
356529489 550 PREDICTED: pentatricopeptide repeat-cont 0.926 0.296 0.363 7e-26
224130828 617 predicted protein [Populus trichocarpa] 0.920 0.262 0.315 2e-25
>gi|224135613|ref|XP_002322117.1| predicted protein [Populus trichocarpa] gi|222869113|gb|EEF06244.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  204 bits (520), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 107/220 (48%), Positives = 136/220 (61%), Gaps = 48/220 (21%)

Query: 4   KECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSI 63
           +E HL+AAL LF  + +RG +PD+ T+NT+IC YC+  RLD+AVQLF K+T  QL+PN+I
Sbjct: 634 REGHLEAALGLFVHVVERGPKPDVFTFNTMICCYCNFKRLDDAVQLFAKMTSEQLRPNAI 693

Query: 64  TFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQN-MKSAFDVYEE 122
           TFTILIDAFC+EGRMDDA +MFSKMLE+GP+ N+VTYSCLI GYFKSQ+ M+S   +Y E
Sbjct: 694 TFTILIDAFCREGRMDDAMLMFSKMLEEGPEPNLVTYSCLIHGYFKSQSMMESGLKLYNE 753

Query: 123 MCENNISPNI-----------------------------------------------AGR 135
           M ENNI+PNI                                                GR
Sbjct: 754 MLENNIAPNIVSYSILIDGLCKRGLMKEASCAFRCALDKHLLPDVIAYTILIRGYCKVGR 813

Query: 136 PTEAMQLYDSMLRNGIMPDGLLLSTLADYNLQSSGSQEHC 175
            TEAM LYD+ML N + PD  L  TL +Y L+ +G++  C
Sbjct: 814 LTEAMMLYDNMLLNRLTPDRFLERTLEEYQLKKAGAKHLC 853




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296088470|emb|CBI37461.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225427506|ref|XP_002263778.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g31840-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|240254191|ref|NP_174467.4| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] gi|357528959|sp|Q9C6S6.2|PPR67_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At1g31840 gi|332193282|gb|AEE31403.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334182978|ref|NP_001185123.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] gi|332193283|gb|AEE31404.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449521772|ref|XP_004167903.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357499959|ref|XP_003620268.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355495283|gb|AES76486.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357499975|ref|XP_003620276.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355495291|gb|AES76494.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356529489|ref|XP_003533323.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|224130828|ref|XP_002328386.1| predicted protein [Populus trichocarpa] gi|222838101|gb|EEE76466.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
TAIR|locus:2034528840 AT1G31840 [Arabidopsis thalian 0.869 0.182 0.445 5.1e-31
TAIR|locus:2031301577 AT1G63400 [Arabidopsis thalian 0.863 0.263 0.346 1.1e-22
TAIR|locus:2164910 747 EMB2745 "EMBRYO DEFECTIVE 2745 0.892 0.210 0.319 1.6e-22
TAIR|locus:1009023134 644 AT1G12775 [Arabidopsis thalian 0.948 0.259 0.312 3.2e-22
TAIR|locus:2026192 630 RPF2 "rna processing factor 2" 0.863 0.241 0.333 2.8e-21
TAIR|locus:2015208 630 AT1G63130 [Arabidopsis thalian 0.863 0.241 0.346 2.8e-21
TAIR|locus:2015228 614 AT1G63080 [Arabidopsis thalian 0.857 0.245 0.341 4.4e-21
TAIR|locus:2015213 629 AT1G63150 [Arabidopsis thalian 0.892 0.249 0.371 1.3e-20
TAIR|locus:2077061 619 AT3G22470 "AT3G22470" [Arabido 0.829 0.235 0.333 1.6e-20
TAIR|locus:504956171650 ABO5 "ABA Overly-Sensitive 5" 0.869 0.235 0.347 1.7e-20
TAIR|locus:2034528 AT1G31840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 351 (128.6 bits), Expect = 5.1e-31, P = 5.1e-31
 Identities = 74/166 (44%), Positives = 100/166 (60%)

Query:     2 LIKECH-LDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKP 60
             L+ +CH ++ A K F  L +  +EPDI+TYNT+ICGYCSL RLDEA ++FE L      P
Sbjct:   610 LLFKCHRIEDASKFFNNLIEGKMEPDIVTYNTMICGYCSLRRLDEAERIFELLKVTPFGP 669

Query:    61 NSITFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVY 120
             N++T TILI   CK   MD A  MFS M EKG K N VTY CL+D + KS +++ +F ++
Sbjct:   670 NTVTLTILIHVLCKNNDMDGAIRMFSIMAEKGSKPNAVTYGCLMDWFSKSVDIEGSFKLF 729

Query:   121 EEMCENNISPNIA------------GRPTEAMQLYDSMLRNGIMPD 154
             EEM E  ISP+I             GR  EA  ++   +   ++PD
Sbjct:   730 EEMQEKGISPSIVSYSIIIDGLCKRGRVDEATNIFHQAIDAKLLPD 775


GO:0005739 "mitochondrion" evidence=ISM
TAIR|locus:2031301 AT1G63400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023134 AT1G12775 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026192 RPF2 "rna processing factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015228 AT1G63080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015213 AT1G63150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077061 AT3G22470 "AT3G22470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956171 ABO5 "ABA Overly-Sensitive 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XV000390
hypothetical protein (854 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-16
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-12
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-11
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-10
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-10
pfam1285434 pfam12854, PPR_1, PPR repeat 4e-10
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-09
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-09
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 4e-08
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-07
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-07
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-07
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-06
pfam0153531 pfam01535, PPR, PPR repeat 1e-06
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 7e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-05
pfam0153531 pfam01535, PPR, PPR repeat 7e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-04
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 0.001
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
 Score = 72.1 bits (178), Expect = 1e-17
 Identities = 24/50 (48%), Positives = 37/50 (74%)

Query: 25 PDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSITFTILIDAFCK 74
          PD++TYNT+I GYC   +++EA++LF ++    +KPN  T++ILID  CK
Sbjct: 1  PDVVTYNTLIDGYCKKGKVEEALKLFNEMKKRGIKPNVYTYSILIDGLCK 50


This repeat has no known function. It is about 35 amino acids long and is found in up to 18 copies in some proteins. The family appears to be greatly expanded in plants and fungi. The repeat has been called PPR. Length = 50

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 176
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 99.97
PLN03077 857 Protein ECB2; Provisional 99.97
PF1304150 PPR_2: PPR repeat family 99.68
PRK11788389 tetratricopeptide repeat protein; Provisional 99.68
PF1304150 PPR_2: PPR repeat family 99.67
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.66
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.58
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.57
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.48
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.46
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.44
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.43
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.4
KOG4422 625 consensus Uncharacterized conserved protein [Funct 99.38
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.38
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 99.37
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.37
PRK12370553 invasion protein regulator; Provisional 99.31
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.3
KOG1126638 consensus DNA-binding cell division cycle control 99.3
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.28
PRK12370553 invasion protein regulator; Provisional 99.27
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.25
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.25
PF1285434 PPR_1: PPR repeat 99.22
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.21
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.2
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.2
PF1285434 PPR_1: PPR repeat 99.19
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.17
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.15
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.15
PRK10370198 formate-dependent nitrite reductase complex subuni 99.15
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.12
PRK11189296 lipoprotein NlpI; Provisional 99.11
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.1
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.09
KOG1129478 consensus TPR repeat-containing protein [General f 99.08
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.07
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.06
KOG1129478 consensus TPR repeat-containing protein [General f 99.06
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 99.04
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 99.03
PRK14574 822 hmsH outer membrane protein; Provisional 99.02
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.0
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.99
PRK15359144 type III secretion system chaperone protein SscB; 98.97
PRK14574 822 hmsH outer membrane protein; Provisional 98.96
PRK11189296 lipoprotein NlpI; Provisional 98.91
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.89
PRK15359144 type III secretion system chaperone protein SscB; 98.89
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.88
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.85
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.84
KOG0547606 consensus Translocase of outer mitochondrial membr 98.82
KOG2076 895 consensus RNA polymerase III transcription factor 98.81
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.8
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.79
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.77
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.77
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.77
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.77
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.74
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.74
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.72
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.72
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.72
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.71
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.71
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.7
KOG1155 559 consensus Anaphase-promoting complex (APC), Cdc23 98.69
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 98.69
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.68
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.66
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.66
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.65
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.64
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 98.63
KOG1126638 consensus DNA-binding cell division cycle control 98.61
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.6
KOG2003 840 consensus TPR repeat-containing protein [General f 98.59
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.59
PRK10370198 formate-dependent nitrite reductase complex subuni 98.58
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.57
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.56
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.56
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 98.55
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.5
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.5
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.49
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.49
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.46
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.46
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.45
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.45
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.45
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.44
KOG2003 840 consensus TPR repeat-containing protein [General f 98.43
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.42
PF06239228 ECSIT: Evolutionarily conserved signalling interme 98.4
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 98.38
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.37
PLN02789320 farnesyltranstransferase 98.36
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.34
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.33
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.33
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.31
KOG2076 895 consensus RNA polymerase III transcription factor 98.28
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.26
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.26
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.25
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.24
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.24
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.21
KOG1125579 consensus TPR repeat-containing protein [General f 98.2
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.2
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.19
KOG0547606 consensus Translocase of outer mitochondrial membr 98.18
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.17
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.16
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.15
KOG0495 913 consensus HAT repeat protein [RNA processing and m 98.12
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 98.12
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.1
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.1
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.1
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.09
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.08
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.08
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.07
KOG1125579 consensus TPR repeat-containing protein [General f 98.03
PF12688120 TPR_5: Tetratrico peptide repeat 98.01
KOG0553304 consensus TPR repeat-containing protein [General f 98.0
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.0
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.0
PLN02789320 farnesyltranstransferase 97.99
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.97
PF12688120 TPR_5: Tetratrico peptide repeat 97.97
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.97
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.95
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.93
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.92
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.92
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.91
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.91
PRK10803263 tol-pal system protein YbgF; Provisional 97.91
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.88
PRK15331165 chaperone protein SicA; Provisional 97.86
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.85
PRK10803263 tol-pal system protein YbgF; Provisional 97.81
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.79
KOG0553304 consensus TPR repeat-containing protein [General f 97.79
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.78
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 97.78
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.78
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.78
PRK15331165 chaperone protein SicA; Provisional 97.77
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.77
PF1337173 TPR_9: Tetratricopeptide repeat 97.75
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.75
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.73
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.72
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.72
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 97.71
KOG3941 406 consensus Intermediate in Toll signal transduction 97.68
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.66
KOG3785557 consensus Uncharacterized conserved protein [Funct 97.65
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.63
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.61
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.59
PF1337173 TPR_9: Tetratricopeptide repeat 97.58
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.5
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.48
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.48
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.47
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.46
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.44
KOG3941 406 consensus Intermediate in Toll signal transduction 97.44
PF13512142 TPR_18: Tetratricopeptide repeat 97.41
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.36
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.35
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 97.35
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.35
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.34
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.31
PRK04841 903 transcriptional regulator MalT; Provisional 97.3
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.28
PRK04841 903 transcriptional regulator MalT; Provisional 97.26
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.23
COG3629280 DnrI DNA-binding transcriptional activator of the 97.22
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.21
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.18
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.08
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 97.07
KOG4555175 consensus TPR repeat-containing protein [Function 96.97
PF1342844 TPR_14: Tetratricopeptide repeat 96.94
smart00299140 CLH Clathrin heavy chain repeat homology. 96.91
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.9
KOG3785557 consensus Uncharacterized conserved protein [Funct 96.87
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.83
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.82
PF13170297 DUF4003: Protein of unknown function (DUF4003) 96.79
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 96.77
COG4700251 Uncharacterized protein conserved in bacteria cont 96.77
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.74
PF13512142 TPR_18: Tetratricopeptide repeat 96.72
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.7
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.7
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.68
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.67
KOG4570 418 consensus Uncharacterized conserved protein [Funct 96.61
COG3629280 DnrI DNA-binding transcriptional activator of the 96.6
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.57
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.55
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.54
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.54
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.54
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 96.49
PF13929292 mRNA_stabil: mRNA stabilisation 96.45
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 96.45
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.39
COG4700251 Uncharacterized protein conserved in bacteria cont 96.38
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.36
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.33
KOG2047 835 consensus mRNA splicing factor [RNA processing and 96.26
KOG4570 418 consensus Uncharacterized conserved protein [Funct 96.19
PF1342844 TPR_14: Tetratricopeptide repeat 96.18
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.14
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.13
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.1
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.08
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.06
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.04
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.93
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 95.89
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 95.88
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.85
PF13170297 DUF4003: Protein of unknown function (DUF4003) 95.79
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.69
PF1343134 TPR_17: Tetratricopeptide repeat 95.67
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.56
PF1343134 TPR_17: Tetratricopeptide repeat 95.54
smart00299140 CLH Clathrin heavy chain repeat homology. 95.52
COG1747 711 Uncharacterized N-terminal domain of the transcrip 95.45
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.45
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 95.42
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.4
KOG4555175 consensus TPR repeat-containing protein [Function 95.39
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 95.38
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 95.25
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 94.94
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.9
PF13929292 mRNA_stabil: mRNA stabilisation 94.83
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.72
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 94.71
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.69
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 94.66
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.66
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.56
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.42
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.41
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 94.03
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 94.03
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.02
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.86
COG3898 531 Uncharacterized membrane-bound protein [Function u 93.67
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.64
PF13762145 MNE1: Mitochondrial splicing apparatus component 93.6
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.52
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 93.33
COG4455273 ImpE Protein of avirulence locus involved in tempe 93.33
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 93.2
KOG1585308 consensus Protein required for fusion of vesicles 93.15
PRK11906458 transcriptional regulator; Provisional 92.93
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.75
KOG1550 552 consensus Extracellular protein SEL-1 and related 92.74
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 92.62
PRK11906458 transcriptional regulator; Provisional 92.61
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 92.5
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 92.43
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.4
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 92.38
COG3898 531 Uncharacterized membrane-bound protein [Function u 92.37
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.27
COG4455 273 ImpE Protein of avirulence locus involved in tempe 92.12
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 92.05
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 92.04
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 91.99
KOG1586288 consensus Protein required for fusion of vesicles 91.96
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 91.78
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 91.69
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.67
KOG4648 536 consensus Uncharacterized conserved protein, conta 91.65
COG3947361 Response regulator containing CheY-like receiver a 91.65
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 91.64
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 91.51
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 91.47
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 91.41
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 91.25
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 91.12
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.04
COG0457291 NrfG FOG: TPR repeat [General function prediction 90.98
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 90.82
cd00280200 TRFH Telomeric Repeat binding Factor or TTAGGG Rep 90.55
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.36
KOG4648 536 consensus Uncharacterized conserved protein, conta 90.26
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 90.26
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 89.97
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 89.58
COG2976207 Uncharacterized protein conserved in bacteria [Fun 89.5
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 89.18
COG3947361 Response regulator containing CheY-like receiver a 88.91
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 88.74
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 88.17
KOG4077149 consensus Cytochrome c oxidase, subunit Va/COX6 [E 88.14
COG0457291 NrfG FOG: TPR repeat [General function prediction 88.13
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 87.97
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 87.95
PF09986214 DUF2225: Uncharacterized protein conserved in bact 87.91
KOG4234271 consensus TPR repeat-containing protein [General f 87.85
PRK11639169 zinc uptake transcriptional repressor; Provisional 87.76
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 87.66
COG2976207 Uncharacterized protein conserved in bacteria [Fun 87.32
PF1184848 DUF3368: Domain of unknown function (DUF3368); Int 86.43
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 86.0
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 85.96
cd0881988 CARD_MDA5_2 Caspase activation and recruitment dom 85.91
PRK10564303 maltose regulon periplasmic protein; Provisional 85.76
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 85.54
KOG2610 491 consensus Uncharacterized conserved protein [Funct 85.35
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 85.23
PF10475291 DUF2450: Protein of unknown function N-terminal do 85.2
KOG1258577 consensus mRNA processing protein [RNA processing 85.19
cd07153116 Fur_like Ferric uptake regulator(Fur) and related 85.02
KOG4507886 consensus Uncharacterized conserved protein, conta 84.97
COG3118304 Thioredoxin domain-containing protein [Posttransla 84.73
KOG1550 552 consensus Extracellular protein SEL-1 and related 84.55
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 84.51
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 84.47
cd0881988 CARD_MDA5_2 Caspase activation and recruitment dom 84.46
PF13762145 MNE1: Mitochondrial splicing apparatus component 84.42
KOG1941 518 consensus Acetylcholine receptor-associated protei 83.8
PRK10564303 maltose regulon periplasmic protein; Provisional 83.73
PF01475120 FUR: Ferric uptake regulator family; InterPro: IPR 83.56
PF11663140 Toxin_YhaV: Toxin with endonuclease activity YhaV; 83.23
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 82.67
PF1468962 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical do 82.66
KOG4234271 consensus TPR repeat-containing protein [General f 82.64
KOG4567370 consensus GTPase-activating protein [General funct 82.46
PRK09462148 fur ferric uptake regulator; Provisional 82.43
cd00280200 TRFH Telomeric Repeat binding Factor or TTAGGG Rep 82.24
PF13934226 ELYS: Nuclear pore complex assembly 81.8
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 81.8
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 81.51
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 81.48
KOG2908 380 consensus 26S proteasome regulatory complex, subun 81.08
COG5159 421 RPN6 26S proteasome regulatory complex component [ 81.01
PF02847113 MA3: MA3 domain; InterPro: IPR003891 This entry re 80.84
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 80.69
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 80.26
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.4e-35  Score=229.01  Aligned_cols=174  Identities=18%  Similarity=0.347  Sum_probs=132.7

Q ss_pred             CchhhCChhHHHHHHHHHhhCCCCccHHHHHHHHHHHHhCCChhHHHHHHHHHHhCCCCcChhhHHHHHHHHHhcCCHHH
Q 030493            1 MLIKECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSITFTILIDAFCKEGRMDD   80 (176)
Q Consensus         1 ~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~~~~~~~~~   80 (176)
                      +|++.|++++|.++|+.|.+.|++|+..+|+.+|.+|++.|++++|+++|++|.+.|+.||..+|+.++++|++.|++++
T Consensus       588 ay~k~G~ldeA~elf~~M~e~gi~p~~~tynsLI~ay~k~G~~deAl~lf~eM~~~Gv~PD~~TynsLI~a~~k~G~~ee  667 (1060)
T PLN03218        588 ACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDK  667 (1060)
T ss_pred             HHHHCCCHHHHHHHHHHHHHcCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHH
Confidence            36677777777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             HHHHHHHHHhcCCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCCC------------CChHHHHHHHHHHHH
Q 030493           81 ATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCENNISPNIA------------GRPTEAMQLYDSMLR  148 (176)
Q Consensus        81 a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~------------~~~~~a~~~~~~m~~  148 (176)
                      |.++|++|.+.|+.|+..+|+.||.+|++.|++++|.++|++|.+.|+.|+..            |++++|.++|++|.+
T Consensus       668 A~~l~~eM~k~G~~pd~~tynsLI~ay~k~G~~eeA~~lf~eM~~~g~~PdvvtyN~LI~gy~k~G~~eeAlelf~eM~~  747 (1060)
T PLN03218        668 AFEILQDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEVLSEMKR  747 (1060)
T ss_pred             HHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Confidence            77777777777777777777777777777777777777777777777777655            777888888888877


Q ss_pred             CCCCCcHHHHHHHHHHhhcccCcccc
Q 030493          149 NGIMPDGLLLSTLADYNLQSSGSQEH  174 (176)
Q Consensus       149 ~g~~p~~~~~~~l~~~~~~~g~~~~A  174 (176)
                      .|+.||..||++++.+|++.|++++|
T Consensus       748 ~Gi~Pd~~Ty~sLL~a~~k~G~le~A  773 (1060)
T PLN03218        748 LGLCPNTITYSILLVASERKDDADVG  773 (1060)
T ss_pred             cCCCCCHHHHHHHHHHHHHCCCHHHH
Confidence            77788888888888888877777665



>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>cd00280 TRFH Telomeric Repeat binding Factor or TTAGGG Repeat binding Factor, central (dimerization) domain Homology; TRFH Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4077 consensus Cytochrome c oxidase, subunit Va/COX6 [Energy production and conversion] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11639 zinc uptake transcriptional repressor; Provisional Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11848 DUF3368: Domain of unknown function (DUF3368); InterPro: IPR021799 This domain is functionally uncharacterised Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>cd08819 CARD_MDA5_2 Caspase activation and recruitment domain found in MDA5, second repeat Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF10475 DUF2450: Protein of unknown function N-terminal domain (DUF2450) ; InterPro: IPR019515 This entry represents Vacuolar protein sorting-associated protein 54, and is thought to be involved in retrograde transport from early and late endosomes to late Golgi found in eukaryotes, but its function is not known Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>cd08819 CARD_MDA5_2 Caspase activation and recruitment domain found in MDA5, second repeat Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK10564 maltose regulon periplasmic protein; Provisional Back     alignment and domain information
>PF01475 FUR: Ferric uptake regulator family; InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins Back     alignment and domain information
>PF11663 Toxin_YhaV: Toxin with endonuclease activity YhaV; InterPro: IPR021679 YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF14689 SPOB_a: Sensor_kinase_SpoOB-type, alpha-helical domain; PDB: 1F51_C 2FTK_B 1IXM_B Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4567 consensus GTPase-activating protein [General function prediction only] Back     alignment and domain information
>PRK09462 fur ferric uptake regulator; Provisional Back     alignment and domain information
>cd00280 TRFH Telomeric Repeat binding Factor or TTAGGG Repeat binding Factor, central (dimerization) domain Homology; TRFH Back     alignment and domain information
>PF13934 ELYS: Nuclear pore complex assembly Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02847 MA3: MA3 domain; InterPro: IPR003891 This entry represents the MI domain (after MA-3 and eIF4G), it is a protein-protein interaction module of ~130 amino acids [, , ] Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-04
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure

Iteration: 1

Score = 42.4 bits (98), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 4/91 (4%) Query: 36 GYCSLNRLDEAVQLFEKLTCVQLKPNSI-TFTILIDAFCKEGRMDDATMMFSKMLEKGPK 94 Y DEA++ ++K ++L P S + L +A+ K+G D+A + K LE P+ Sbjct: 10 AYYKQGDYDEAIEYYQK--ALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPR 67 Query: 95 ANVVTYSCLIDGYFKSQNMKSAFDVYEEMCE 125 + Y+ L + Y+K + A + Y++ E Sbjct: 68 SAEAWYN-LGNAYYKQGDYDEAIEYYQKALE 97

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-05
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-04
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-04
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-04
2gw1_A 514 Mitochondrial precursor proteins import receptor; 6e-04
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-05
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-04
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 9e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 69.5 bits (168), Expect = 2e-14
 Identities = 14/129 (10%), Positives = 40/129 (31%), Gaps = 4/129 (3%)

Query: 7   HLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKL---TCVQLKPNSI 63
            LD      GQ +   L                 ++L  A  L          +      
Sbjct: 107 SLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLD 166

Query: 64  TFTILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKS-QNMKSAFDVYEE 122
            +  ++  + ++G   +   +   + + G   ++++Y+  +    +  Q+  +     E+
Sbjct: 167 MYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQ 226

Query: 123 MCENNISPN 131
           M +  +   
Sbjct: 227 MSQEGLKLQ 235


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 100.0
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.91
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.89
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.83
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.82
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.7
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.67
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.66
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.63
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.63
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.63
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.62
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.61
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.61
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.59
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.58
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.58
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.58
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.58
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.58
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.56
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.56
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.55
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.55
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.54
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.54
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.54
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.53
3u4t_A272 TPR repeat-containing protein; structural genomics 99.53
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.53
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.52
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.51
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.5
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.5
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.49
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.48
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.48
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.46
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.45
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.45
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.44
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.44
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.43
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.41
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.41
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.4
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.4
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.39
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.39
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.39
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.38
3u4t_A272 TPR repeat-containing protein; structural genomics 99.35
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.33
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.3
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.3
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.3
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.26
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.25
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.25
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.24
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.23
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.22
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.22
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.21
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.21
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.2
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.2
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.19
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.18
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.16
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.16
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.15
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.14
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.14
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.13
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.13
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.11
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.11
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.1
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.1
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.09
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.09
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.09
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.09
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.08
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.08
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.07
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.06
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.05
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.05
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.05
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.04
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.03
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.03
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.02
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.02
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.02
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.02
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.01
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.01
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.01
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.0
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.0
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.0
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.99
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.98
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.98
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.98
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.98
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.95
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.95
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.93
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.92
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.91
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.91
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.91
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.91
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.9
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.9
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.9
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.9
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.9
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.9
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.9
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.88
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.88
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.88
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.87
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.87
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.87
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.85
3k9i_A117 BH0479 protein; putative protein binding protein, 98.85
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.84
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.83
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.83
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.82
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.82
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.82
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.81
3k9i_A117 BH0479 protein; putative protein binding protein, 98.8
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.8
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.79
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.79
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.79
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.77
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.77
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.77
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.76
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.75
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.75
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.74
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.73
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.72
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.72
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.71
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.71
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.69
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.69
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.68
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.68
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.67
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.66
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.65
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.64
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.6
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.58
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.57
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.57
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.55
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.5
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.49
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.49
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.46
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.45
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.44
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.43
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.43
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.41
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.39
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.39
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.38
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.37
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.33
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.28
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.23
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.21
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.21
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.2
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.17
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.15
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.13
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.12
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.08
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.99
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.98
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.91
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.89
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.87
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.83
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.81
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.81
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.75
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.74
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.71
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.71
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.55
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.54
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.5
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.5
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.47
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.41
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.36
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.34
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.33
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.28
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.25
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.17
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.08
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.03
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.71
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.68
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.66
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.62
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.3
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.01
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 95.98
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.84
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.81
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 95.75
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.53
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 95.15
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.75
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 94.4
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.29
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 93.88
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.59
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.22
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 93.0
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 92.2
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.7
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 91.65
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 91.42
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.39
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.32
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 90.25
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 90.16
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 88.65
2uwj_G115 Type III export protein PSCG; virulence, chaperone 88.16
2p58_C116 Putative type III secretion protein YSCG; type III 87.99
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 87.97
3eyy_A145 Putative iron uptake regulatory protein; NUR, nick 86.18
1mzb_A136 Ferric uptake regulation protein; ferric uptake re 85.61
2xig_A150 Ferric uptake regulation protein; hpfur, transcrip 85.15
2w57_A150 Ferric uptake regulation protein; gene regulation, 85.1
2fe3_A145 Peroxide operon regulator; oxidative stress regula 84.54
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 84.48
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 83.21
3bu8_A235 Telomeric repeat-binding factor 2; TRF2 TRFH domai 82.73
2d2s_A235 Exocyst complex component EXO84; tethering complex 82.51
2ion_A152 PDCD4, programmed cell death 4, PDCD4; alpha-helic 82.38
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 82.22
4ets_A162 Ferric uptake regulation protein; metal binding pr 81.9
2uwj_G115 Type III export protein PSCG; virulence, chaperone 81.66
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 81.5
2p58_C116 Putative type III secretion protein YSCG; type III 80.81
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 80.25
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
Probab=100.00  E-value=9.4e-38  Score=229.44  Aligned_cols=170  Identities=15%  Similarity=0.222  Sum_probs=163.5

Q ss_pred             CchhhCChhHHHHHHHHHhhCCCCccHHHHHHHHHHHHhCCC---------hhHHHHHHHHHHhCCCCcChhhHHHHHHH
Q 030493            1 MLIKECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNR---------LDEAVQLFEKLTCVQLKPNSITFTILIDA   71 (176)
Q Consensus         1 ~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~---------~~~a~~~~~~m~~~~~~~~~~~~~~ll~~   71 (176)
                      +|++.|++++|+++|++|.+.|++||..+||+||.+|++.+.         +++|.++|++|...|+.||..||++||.+
T Consensus        35 ~c~k~G~~~~A~~lf~~M~~~Gv~pd~~tyn~Li~~c~~~~~~~~~~~~~~l~~A~~lf~~M~~~G~~Pd~~tyn~lI~~  114 (501)
T 4g26_A           35 MCSKKGDVLEALRLYDEARRNGVQLSQYHYNVLLYVCSLAEAATESSPNPGLSRGFDIFKQMIVDKVVPNEATFTNGARL  114 (501)
T ss_dssp             HTTTSCCHHHHHHHHHHHHHHTCCCCHHHHHHHHHHHTTCCCCSSSSCCHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHH
T ss_pred             HHHhCCCHHHHHHHHHHHHHcCCCCCHhHHHHHHHHHHhCCchhhhhhcchHHHHHHHHHHHHHhCCCCCHHHHHHHHHH
Confidence            489999999999999999999999999999999999998765         67899999999999999999999999999


Q ss_pred             HHhcCCHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCCC------------CChHHH
Q 030493           72 FCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCENNISPNIA------------GRPTEA  139 (176)
Q Consensus        72 ~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~------------~~~~~a  139 (176)
                      |++.|++++|.++|++|.+.|+.||..+|+.+|.+|++.|++++|.++|++|.+.|+.|+..            |+.++|
T Consensus       115 ~~~~g~~~~A~~l~~~M~~~g~~Pd~~tyn~lI~~~~~~g~~~~A~~l~~~M~~~G~~Pd~~ty~~Li~~~~~~g~~d~A  194 (501)
T 4g26_A          115 AVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFCRKGDADKAYEVDAHMVESEVVPEEPELAALLKVSMDTKNADKV  194 (501)
T ss_dssp             HHHHTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHTTCHHHH
T ss_pred             HHhcCCHHHHHHHHHHHHHcCCCCccceehHHHHHHHHCCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhhCCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999988            999999


Q ss_pred             HHHHHHHHHCCCCCcHHHHHHHHHHhhcccC
Q 030493          140 MQLYDSMLRNGIMPDGLLLSTLADYNLQSSG  170 (176)
Q Consensus       140 ~~~~~~m~~~g~~p~~~~~~~l~~~~~~~g~  170 (176)
                      .++|++|.+.|..|+..||+.++..|+..+.
T Consensus       195 ~~ll~~Mr~~g~~ps~~T~~~l~~~F~s~~a  225 (501)
T 4g26_A          195 YKTLQRLRDLVRQVSKSTFDMIEEWFKSEVA  225 (501)
T ss_dssp             HHHHHHHHHHTSSBCHHHHHHHHHHHHSHHH
T ss_pred             HHHHHHHHHhCCCcCHHHHHHHHHHHhcCcc
Confidence            9999999999999999999999999987543



>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3eyy_A Putative iron uptake regulatory protein; NUR, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 Back     alignment and structure
>2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} Back     alignment and structure
>2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae} Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>3bu8_A Telomeric repeat-binding factor 2; TRF2 TRFH domain TRF2 dimerization domain TIN2 peptide, alternative splicing, cell cycle, chromosomal protein; 2.15A {Homo sapiens} SCOP: a.146.1.1 PDB: 3bua_A* 1h6p_A Back     alignment and structure
>2d2s_A Exocyst complex component EXO84; tethering complex, EXO84P, endocytosis/exocytosis complex; 2.85A {Saccharomyces cerevisiae} SCOP: a.118.17.2 Back     alignment and structure
>2ion_A PDCD4, programmed cell death 4, PDCD4; alpha-helical, antitumor protein; 1.57A {Mus musculus} SCOP: a.118.1.14 PDB: 2ios_A 2iol_A Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>4ets_A Ferric uptake regulation protein; metal binding protein, transcription factor; 2.10A {Campylobacter jejuni subsp} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 176
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-05
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.4 bits (93), Expect = 5e-05
 Identities = 26/155 (16%), Positives = 58/155 (37%), Gaps = 20/155 (12%)

Query: 8   LDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSI-TFT 66
            D A+  + +          + +  + C Y     +D A+  + +   ++L+P+    + 
Sbjct: 219 FDRAVAAYLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRR--AIELQPHFPDAYC 275

Query: 67  ILIDAFCKEGRMDDATMMFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCEN 126
            L +A  ++G + +A   ++  L   P         L +   +  N++ A  +Y +  E 
Sbjct: 276 NLANALKEKGSVAEAEDCYNTALRLCPTHADSLN-NLANIKREQGNIEEAVRLYRKALE- 333

Query: 127 NISPNIA-------------GRPTEAMQLYDSMLR 148
            + P  A             G+  EA+  Y   +R
Sbjct: 334 -VFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR 367


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.52
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.51
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.51
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.3
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.3
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.26
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.19
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.19
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.13
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.11
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.09
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.07
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.95
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.93
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.92
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.92
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 98.85
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.84
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.8
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.78
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.76
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.75
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.7
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.63
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.61
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.6
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.57
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.57
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.54
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.49
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.47
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.46
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.41
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.37
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.36
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.31
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.28
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.2
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.14
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.02
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.02
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.96
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.88
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.8
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.55
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.46
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.31
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.16
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.52
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.28
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.16
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.07
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.76
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.45
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 95.37
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.1
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 93.78
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 93.66
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 92.57
d1mzba_134 Ferric uptake regulation protein, FUR {Pseudomonas 91.69
d1u9pa136 Arc repressor {Salmonella bacteriophage P22 [TaxId 87.05
d1h6pa_203 TRF2 {Human (Homo sapiens) [TaxId: 9606]} 84.99
d2f6ma164 Vacuolar protein sorting-associated protein 23, VP 83.03
d1mzba_134 Ferric uptake regulation protein, FUR {Pseudomonas 82.66
d2nsza1129 Programmed cell death 4, PDCD4 {Mouse (Mus musculu 81.66
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.52  E-value=2.1e-12  Score=89.37  Aligned_cols=159  Identities=16%  Similarity=0.223  Sum_probs=76.6

Q ss_pred             hhCChhHHHHHHHHHhhCCCCccHHHHHHHHHHHHhCCChhHHHHHHHHHHhCCCCcChhhHHHHHHHHHhcCCHHHHHH
Q 030493            4 KECHLDAALKLFGQLTDRGLEPDIITYNTIICGYCSLNRLDEAVQLFEKLTCVQLKPNSITFTILIDAFCKEGRMDDATM   83 (176)
Q Consensus         4 ~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~   83 (176)
                      ..|++++|...++.....+ +.+...+..+...+.+.|++++|+..|++..+... -+..++..+...+...|++++|.+
T Consensus       215 ~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p-~~~~~~~~l~~~~~~~~~~~~A~~  292 (388)
T d1w3ba_         215 EARIFDRAVAAYLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQP-HFPDAYCNLANALKEKGSVAEAED  292 (388)
T ss_dssp             TTTCTTHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCS-SCHHHHHHHHHHHHHHSCHHHHHH
T ss_pred             ccccHHHHHHHHHHhHHHh-hhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHHHHcCCHHHHHH
Confidence            3445555555555544432 22444444455555555555555555555444321 134444555555555555555555


Q ss_pred             HHHHHHhcCCCCcHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCCC-------------CChHHHHHHHHHHHHCC
Q 030493           84 MFSKMLEKGPKANVVTYSCLIDGYFKSQNMKSAFDVYEEMCENNISPNIA-------------GRPTEAMQLYDSMLRNG  150 (176)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~-------------~~~~~a~~~~~~m~~~g  150 (176)
                      .++...... +.+...+..+...+.+.|++++|+..|++..+.  .|+..             |++++|.+.|++..+. 
T Consensus       293 ~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l-  368 (388)
T d1w3ba_         293 CYNTALRLC-PTHADSLNNLANIKREQGNIEEAVRLYRKALEV--FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI-  368 (388)
T ss_dssp             HHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS--CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT-
T ss_pred             HHHhhhccC-CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh-
Confidence            555554442 224445555555555555555555555554432  22222             5555555555555432 


Q ss_pred             CCCc-HHHHHHHHHHhhccc
Q 030493          151 IMPD-GLLLSTLADYNLQSS  169 (176)
Q Consensus       151 ~~p~-~~~~~~l~~~~~~~g  169 (176)
                       .|+ ...+..+..++.+.|
T Consensus       369 -~P~~~~a~~~lg~~~~~~~  387 (388)
T d1w3ba_         369 -SPTFADAYSNMGNTLKEMQ  387 (388)
T ss_dssp             -CTTCHHHHHHHHHHHHHTC
T ss_pred             -CCCCHHHHHHHHHHHHHcC
Confidence             333 334445555554444



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u9pa1 a.43.1.1 (A:72-107) Arc repressor {Salmonella bacteriophage P22 [TaxId: 10754]} Back     information, alignment and structure
>d1h6pa_ a.146.1.1 (A:) TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f6ma1 a.2.17.1 (A:322-385) Vacuolar protein sorting-associated protein 23, VPS23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure