Query         030495
Match_columns 176
No_of_seqs    55 out of 57
Neff          2.0 
Searched_HMMs 46136
Date          Fri Mar 29 14:35:06 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030495.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030495hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12077 DUF3556:  Transmembran  72.1     2.3   5E-05   41.2   1.8   49   80-128   118-167 (574)
  2 PF12270 Cyt_c_ox_IV:  Cytochro  36.7      29 0.00062   28.1   2.2   22  115-136   113-134 (137)
  3 PF12955 DUF3844:  Domain of un  27.3 2.3E+02   0.005   22.0   5.7   39   76-129    48-86  (103)
  4 KOG0593 Predicted protein kina  23.2      20 0.00044   33.6  -0.8   18  122-139   184-202 (396)
  5 PF12301 CD99L2:  CD99 antigen   21.0      23  0.0005   29.2  -0.8   10   46-55    133-142 (169)
  6 TIGR00752 slp outer membrane l  18.6      72  0.0016   26.6   1.5   10    3-12     11-20  (182)
  7 KOG1614 Exosomal 3'-5' exoribo  17.7   1E+02  0.0022   28.1   2.3   42  114-160   145-200 (291)
  8 PF04120 Iron_permease:  Low af  16.9 1.2E+02  0.0026   24.2   2.4   40  108-147    13-52  (132)
  9 PF03941 INCENP_ARK-bind:  Inne  14.6      54  0.0012   22.0  -0.1    8   90-97     18-25  (57)
 10 PF08122 NDUF_B12:  NADH-ubiqui  14.3 1.1E+02  0.0023   21.0   1.3   11   91-101     3-13  (57)

No 1  
>PF12077 DUF3556:  Transmembrane protein of unknown function (DUF3556);  InterPro: IPR021941  This family of transmembrane proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 576 to 592 amino acids in length. 
Probab=72.09  E-value=2.3  Score=41.22  Aligned_cols=49  Identities=24%  Similarity=0.529  Sum_probs=40.7

Q ss_pred             CCCCCCCCCCCCCc-ccccCCCcCCCCccCchHHHHHHHHHHHHHHHhcc
Q 030495           80 PSWAKPDSDEPPPW-ATDEGKGLTSQGSFEIPFYVYLLTSTITAIAAIGS  128 (176)
Q Consensus        80 pswAkp~sde~PPW-aR~E~~~~~a~~~~~lPfgvyLl~ScItAIAAVGS  128 (176)
                      =-|.+|+.-.+||| .|--.-+......+|+=.|+-|+.+.+.|++.=|.
T Consensus       118 lyWlRpgTIRLpPWP~~VP~T~Gd~Rt~~DV~LYaalL~~lv~aL~~pG~  167 (574)
T PF12077_consen  118 LYWLRPGTIRLPPWPGRVPLTAGDRRTPFDVALYAALLASLVVALLSPGT  167 (574)
T ss_pred             eEEecCCceeCCCCCCCCCCCCCCcCchHHHHHHHHHHHHHHHHHcCCCC
Confidence            45999999999999 55555555556788999999999999999998777


No 2  
>PF12270 Cyt_c_ox_IV:  Cytochrome c oxidase subunit IV;  InterPro: IPR021050  This family of proteins is found in bacteria. Proteins in this family are approximately 140 amino acids in length. This family is the fourth subunit of the cytochrome c oxidase complex. This subunit does not have a catalytic capacity but instead, is required for assembly and/or stability of the complex []. ; GO: 0004129 cytochrome-c oxidase activity, 0055114 oxidation-reduction process, 0016021 integral to membrane
Probab=36.70  E-value=29  Score=28.10  Aligned_cols=22  Identities=27%  Similarity=0.579  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHhcceeEeecCC
Q 030495          115 LLTSTITAIAAIGSIFEYVNKN  136 (176)
Q Consensus       115 Ll~ScItAIAAVGSIFElssg~  136 (176)
                      +++..++.++++|=+|||..|+
T Consensus       113 ~iG~~~~i~~~~G~vfEy~rg~  134 (137)
T PF12270_consen  113 LIGAVLLIVAVVGWVFEYYRGP  134 (137)
T ss_pred             HHHHHHHHHHHHHHhheeccCc
Confidence            3445567788999999998875


No 3  
>PF12955 DUF3844:  Domain of unknown function (DUF3844);  InterPro: IPR024382 This presumed domain is found in fungal species. It contains 8 largely conserved cysteine residues. This domain is found in proteins thought to be located in the endoplasmic reticulum.
Probab=27.29  E-value=2.3e+02  Score=22.03  Aligned_cols=39  Identities=15%  Similarity=0.476  Sum_probs=25.2

Q ss_pred             ccCCCCCCCCCCCCCCCcccccCCCcCCCCccCchHHHHHHHHHHHHHHHhcce
Q 030495           76 EETIPSWAKPDSDEPPPWATDEGKGLTSQGSFEIPFYVYLLTSTITAIAAIGSI  129 (176)
Q Consensus        76 ~e~~pswAkp~sde~PPWaR~E~~~~~a~~~~~lPfgvyLl~ScItAIAAVGSI  129 (176)
                      ..|...|+-+.=+               .+..-.||-+|+..+.+..++.+++|
T Consensus        48 ~~ktt~W~G~aCq---------------KkDvS~~F~L~~~~ti~lv~~~~~~I   86 (103)
T PF12955_consen   48 KGKTTHWGGPACQ---------------KKDVSVPFWLFAGFTIALVVLVAGAI   86 (103)
T ss_pred             cCceeeecccccc---------------cccccchhhHHHHHHHHHHHHHHHHH
Confidence            3477788765421               23445899998888777666655555


No 4  
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only]
Probab=23.18  E-value=20  Score=33.60  Aligned_cols=18  Identities=39%  Similarity=0.778  Sum_probs=14.6

Q ss_pred             HHHHhccee-EeecCCCcc
Q 030495          122 AIAAIGSIF-EYVNKNPVF  139 (176)
Q Consensus       122 AIAAVGSIF-Elssg~P~f  139 (176)
                      -|-|||||| |++.|+|-|
T Consensus       184 DiWAiGCv~aEl~~G~pL~  202 (396)
T KOG0593|consen  184 DIWAIGCVFAELLTGEPLW  202 (396)
T ss_pred             cchhhhHHHHHHhcCCcCC
Confidence            356888887 999999965


No 5  
>PF12301 CD99L2:  CD99 antigen like protein 2;  InterPro: IPR022078  This family of proteins is found in eukaryotes. Proteins in this family are typically between 165 and 237 amino acids in length. CD99L2 and CD99 are involved in trans-endothelial migration of neutrophils in vitro and in the recruitment of neutrophils into inflamed peritoneum. 
Probab=20.98  E-value=23  Score=29.22  Aligned_cols=10  Identities=60%  Similarity=0.853  Sum_probs=9.1

Q ss_pred             CCcccccccc
Q 030495           46 PSYHAFQNKK   55 (176)
Q Consensus        46 ~~~~~~~~~k   55 (176)
                      .||++|||||
T Consensus       133 sSyiaYqkKK  142 (169)
T PF12301_consen  133 SSYIAYQKKK  142 (169)
T ss_pred             HHHHHHHhhc
Confidence            5899999999


No 6  
>TIGR00752 slp outer membrane lipoprotein, Slp family. Slp superfamily members are present in the Gram-negative gamma proteobacteria Escherichia coli, which also contains a close paralog, Haemophilus influenzae and Pasteurella multocida and Vibrio cholera. The known members of the family to date share a motif LX[GA]C near the N-terminus, which is compatible with the possibility that the protein is modified into a lipoprotein with Cys as the new N-terminus. Slp from Escherichia coli is known to be a lipoprotein of the outer membrane and to be expressed in response to carbon starvation.
Probab=18.64  E-value=72  Score=26.57  Aligned_cols=10  Identities=10%  Similarity=-0.117  Sum_probs=7.8

Q ss_pred             cceeeccCCc
Q 030495            3 SATILSSSSC   12 (176)
Q Consensus         3 ~a~~~~~~~~   12 (176)
                      +|++|+.|.+
T Consensus        11 ~~l~LsgCas   20 (182)
T TIGR00752        11 LCFGLTGCIA   20 (182)
T ss_pred             HHHHHhcccC
Confidence            4677888988


No 7  
>KOG1614 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp45 [Translation, ribosomal structure and biogenesis]
Probab=17.67  E-value=1e+02  Score=28.13  Aligned_cols=42  Identities=24%  Similarity=0.209  Sum_probs=31.6

Q ss_pred             HHHHHHHHHHHHhcceeEeecCCCccccccC--------------Cceehhhhccceeeec
Q 030495          114 YLLTSTITAIAAIGSIFEYVNKNPVFGILNS--------------DSIFYAPLLGFFAFTG  160 (176)
Q Consensus       114 yLl~ScItAIAAVGSIFElssg~P~fGv~~t--------------d~iLYaPiLgFF~~Tg  160 (176)
                      ++=++||++|||.=     .-++|+.-+.+-              -+|+|.||-.+|.|.+
T Consensus       145 lvDaA~iAviaaL~-----hFrrPdvTv~g~ev~ihp~eEr~PvPL~I~HmPIC~tf~ffn  200 (291)
T KOG1614|consen  145 LVDAACIAVIAALM-----HFRRPDVTVGGEEVIIHPVEEREPVPLSIHHMPICFTFGFFN  200 (291)
T ss_pred             eehhHHHHHHHHHH-----hcCCCCcccccceeEecChhccCCcceeeeeccceEEEEEec
Confidence            45689999999973     357888777654              4677888988888765


No 8  
>PF04120 Iron_permease:  Low affinity iron permease ;  InterPro: IPR007251  Although originally identified as a low-affinity iron(II) permease [, ], Fet4 has since been shown to import several other transition metal ions, including copper [, ] and zinc []. Copper, cobalt, and cadmium inhibit Fet4 [, ]. Fet4 is an integral protein of the plasma membrane [, ]. FET4 is not essential, not even in fet3 fet4 double mutants []. Over expression of FET4 improves growth under alkaline conditions [].   Transcription of FET4 is induced by Aft1 in response to low levels of iron [, , ] or by Zap1 in response to low zinc [, ], but not in response to low copper []. When the high-affinity iron permease component Fet3 is deleted, FET4 is induced by the addition of copper, zinc, cobalt, or manganese []. It is also induced under anaerobic conditions [, , ] and repressed by Rox1 in aerobic conditions [, ]. Rox1 attenuates the activation of FET4 by Aft1 or Zap1 []. ; GO: 0055085 transmembrane transport
Probab=16.85  E-value=1.2e+02  Score=24.17  Aligned_cols=40  Identities=15%  Similarity=0.212  Sum_probs=29.5

Q ss_pred             CchHHHHHHHHHHHHHHHhcceeEeecCCCccccccCCce
Q 030495          108 EIPFYVYLLTSTITAIAAIGSIFEYVNKNPVFGILNSDSI  147 (176)
Q Consensus       108 ~lPfgvyLl~ScItAIAAVGSIFElssg~P~fGv~~td~i  147 (176)
                      +-|+...+.+.+|.+-++.|.+|.++.-==-+=+.+|.++
T Consensus        13 gs~~~f~~~~~~Ii~W~i~Gp~~~~sdtWQLviNt~ttIi   52 (132)
T PF04120_consen   13 GSPWAFVIAVAVIIVWAISGPVFGFSDTWQLVINTATTII   52 (132)
T ss_pred             CCHHHHHHHHHHHHHHHHHhccccCcchHHHHHccHHHHH
Confidence            4689999999999999999999998754333333444443


No 9  
>PF03941 INCENP_ARK-bind:  Inner centromere protein, ARK binding region;  InterPro: IPR005635 This region of the inner centromere protein has been found to be necessary and sufficient for binding to aurora-related kinase. This interaction has been implicated in the coordination of chromosome segregation with cell division in yeast [].; PDB: 2BFX_C 2BFY_C 3ZTX_D 2VGO_D 2VGP_D 2VRX_D 4AF3_D.
Probab=14.62  E-value=54  Score=22.05  Aligned_cols=8  Identities=38%  Similarity=0.916  Sum_probs=2.8

Q ss_pred             CCCccccc
Q 030495           90 PPPWATDE   97 (176)
Q Consensus        90 ~PPWaR~E   97 (176)
                      .|.||+.+
T Consensus        18 iP~WA~~~   25 (57)
T PF03941_consen   18 IPSWAQSP   25 (57)
T ss_dssp             --GGGSHH
T ss_pred             CCCCcCcH
Confidence            44555443


No 10 
>PF08122 NDUF_B12:  NADH-ubiquinone oxidoreductase B12 subunit family;  InterPro: IPR012576  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family consists of the B12 subunit of NADH:ubiquinone oxidoreductase proteins. The function of this subunit is unclear [].; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0005739 mitochondrion
Probab=14.27  E-value=1.1e+02  Score=21.04  Aligned_cols=11  Identities=36%  Similarity=0.761  Sum_probs=8.6

Q ss_pred             CCcccccCCCc
Q 030495           91 PPWATDEGKGL  101 (176)
Q Consensus        91 PPWaR~E~~~~  101 (176)
                      -||+|+|.=|-
T Consensus         3 DPW~RneaWRy   13 (57)
T PF08122_consen    3 DPWARNEAWRY   13 (57)
T ss_pred             ChHhhhHHHhC
Confidence            38999997664


Done!