BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 030500
(176 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3MNV|A Chain A, Crystal Structure Of The Non-Neutralizing Hiv Antibody
13h11 Fab Fragment
pdb|3MNV|C Chain C, Crystal Structure Of The Non-Neutralizing Hiv Antibody
13h11 Fab Fragment
pdb|3MNW|A Chain A, Crystal Structure Of The Non-Neutralizing Hiv Antibody
13h11 Fab Fragment With A Gp41 Mper-Derived Peptide In A
Helical Conformation
pdb|3MNZ|A Chain A, Crystal Structure Of The Non-Neutralizing Hiv Antibody
13h11 Fab Fragment With A Gp41 Mper-Derived Peptide
Bearing Ala Substitutions In A Helical Conformation
pdb|3MO1|A Chain A, Crystal Structure Of The Non-Neutralizing Hiv Antibody
13h11 Fab Fragment
Length = 224
Score = 29.6 bits (65), Expect = 1.0, Method: Compositional matrix adjust.
Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 3/32 (9%)
Query: 94 AENISD---LTHYAPPWNYNRGRKKPVSREVA 122
AE+++D L HY PW + G K + R VA
Sbjct: 88 AEDLADYFCLQHYNTPWTFGGGTKLEIKRTVA 119
>pdb|1NCA|L Chain L, Refined Crystal Structure Of The Influenza Virus N9
Neuraminidase-Nc41 Fab Complex
pdb|1NCB|L Chain L, Crystal Structures Of Two Mutant Neuraminidase-Antibody
Complexes With Amino Acid Substitutions In The Interface
pdb|1NCC|L Chain L, Crystal Structures Of Two Mutant Neuraminidase-Antibody
Complexes With Amino Acid Substitutions In The Interface
pdb|1NCD|L Chain L, Refined Crystal Structure Of The Influenza Virus N9
Neuraminidase-Nc41 Fab Complex
Length = 214
Score = 26.9 bits (58), Expect = 6.0, Method: Compositional matrix adjust.
Identities = 9/21 (42%), Positives = 12/21 (57%)
Query: 102 HYAPPWNYNRGRKKPVSREVA 122
HY+PPW + G K + R A
Sbjct: 91 HYSPPWTFGGGTKLEIKRADA 111
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.131 0.378
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,308,543
Number of Sequences: 62578
Number of extensions: 154810
Number of successful extensions: 378
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 377
Number of HSP's gapped (non-prelim): 5
length of query: 176
length of database: 14,973,337
effective HSP length: 92
effective length of query: 84
effective length of database: 9,216,161
effective search space: 774157524
effective search space used: 774157524
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)