Citrus Sinensis ID: 030509

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MKYVKPLRLFEQMLKRKVSKRGRFLGLDVGDKYVGLSISDPKNKIASPLSVLLRKKNTIDLMAEDFRSLISEFNLEGFIVGYPFNRQQNAADAVQVKLFIDDLSATKKLEDMKYAYWNEGFTSKGVELLLNPLDLHPVEYKTILDKFAAVGILQEYLDNANRKVNLKANVLRPIIN
cccccHHHHHHHHHHHHccccccEEEEEccccEEEEEEEccccccccccEEEEcccccHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcHHccccccccccccccc
****KPLRLFEQMLKRKVSKRGRFLGLDVGDKYVGLSISDPKNKIASPLSVLLRKKNTIDLMAEDFRSLISEFNLEGFIVGYPFNRQQNAADAVQVKLFIDDLSATKKLEDMKYAYWNEGFTSKGVELLLNPLDLHPVEYKTILDKFAAVGILQEYLDNANRKVNLKANVLR****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYVKPLRLFEQMLKRKVSKRGRFLGLDVGDKYVGLSISDPKNKIASPLSVLLRKKNTIDLMAEDFRSLISEFNLEGFIVGYPFNRQQNAADAVQVKLFIDDLSATKKLEDMKYAYWNEGFTSKGVELLLNPLDLHPVEYKTILDKFAAVGILQEYLDNANRKVNLKANVLRPIIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative Holliday junction resolvase Could be a nuclease that resolves Holliday junction intermediates in genetic recombination.probableB2IEC1
Putative Holliday junction resolvase Could be a nuclease that resolves Holliday junction intermediates in genetic recombination.probableQ5NPF1
Putative Holliday junction resolvase Could be a nuclease that resolves Holliday junction intermediates in genetic recombination.probableB8EPC5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VHX, chain A
Confidence level:very confident
Coverage over the Query: 22-162
View the alignment between query and template
View the model in PyMOL