BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 030517
(176 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2FI7|A Chain A, Crystal Structure Of Pilf : Functional Implication In The
Type 4 Pilus Biogenesis In Pseudomonas Aeruginosa
pdb|2FI7|B Chain B, Crystal Structure Of Pilf : Functional Implication In The
Type 4 Pilus Biogenesis In Pseudomonas Aeruginosa
Length = 265
Score = 26.6 bits (57), Expect = 7.6, Method: Compositional matrix adjust.
Identities = 12/37 (32%), Positives = 20/37 (54%)
Query: 138 TDLYYQKMIQADPRNPLLLSNYARFLKEVNFCSKSFS 174
D Y+K + +D RN +L+NY FL E +++
Sbjct: 103 ADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQ 139
>pdb|2HO1|A Chain A, Functional Characterization Of Pseudomonas Aeruginosa Pilf
pdb|2HO1|B Chain B, Functional Characterization Of Pseudomonas Aeruginosa Pilf
Length = 252
Score = 26.6 bits (57), Expect = 7.8, Method: Compositional matrix adjust.
Identities = 12/37 (32%), Positives = 20/37 (54%)
Query: 138 TDLYYQKMIQADPRNPLLLSNYARFLKEVNFCSKSFS 174
D Y+K + +D RN +L+NY FL E +++
Sbjct: 90 ADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQ 126
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.313 0.128 0.383
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,248,044
Number of Sequences: 62578
Number of extensions: 124908
Number of successful extensions: 298
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 296
Number of HSP's gapped (non-prelim): 2
length of query: 176
length of database: 14,973,337
effective HSP length: 92
effective length of query: 84
effective length of database: 9,216,161
effective search space: 774157524
effective search space used: 774157524
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 48 (23.1 bits)