BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030517
         (176 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2FI7|A Chain A, Crystal Structure Of Pilf : Functional Implication In The
           Type 4 Pilus Biogenesis In Pseudomonas Aeruginosa
 pdb|2FI7|B Chain B, Crystal Structure Of Pilf : Functional Implication In The
           Type 4 Pilus Biogenesis In Pseudomonas Aeruginosa
          Length = 265

 Score = 26.6 bits (57), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 138 TDLYYQKMIQADPRNPLLLSNYARFLKEVNFCSKSFS 174
            D  Y+K + +D RN  +L+NY  FL E     +++ 
Sbjct: 103 ADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQ 139


>pdb|2HO1|A Chain A, Functional Characterization Of Pseudomonas Aeruginosa Pilf
 pdb|2HO1|B Chain B, Functional Characterization Of Pseudomonas Aeruginosa Pilf
          Length = 252

 Score = 26.6 bits (57), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 138 TDLYYQKMIQADPRNPLLLSNYARFLKEVNFCSKSFS 174
            D  Y+K + +D RN  +L+NY  FL E     +++ 
Sbjct: 90  ADEEYRKALASDSRNARVLNNYGGFLYEQKRYEEAYQ 126


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.313    0.128    0.383 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,248,044
Number of Sequences: 62578
Number of extensions: 124908
Number of successful extensions: 298
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 296
Number of HSP's gapped (non-prelim): 2
length of query: 176
length of database: 14,973,337
effective HSP length: 92
effective length of query: 84
effective length of database: 9,216,161
effective search space: 774157524
effective search space used: 774157524
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 48 (23.1 bits)