BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 030563
(175 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q5RDE3|CEP70_PONAB Centrosomal protein of 70 kDa OS=Pongo abelii GN=CEP70 PE=2 SV=1
Length = 597
Score = 30.4 bits (67), Expect = 6.8, Method: Composition-based stats.
Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 9/69 (13%)
Query: 93 DHQKSRSRSSSTKKKRRE-QSQSNANNNTNNVNS--------ISMTTNLLVSDQYLSEIL 143
D+ +S+ R T+++ +E +SQS N+ N+++ +S+ L S + +L
Sbjct: 218 DYYESKIRKIHTQRQYKEDESQSEEENDYRNLDASPTYKGLLMSLQNQLKESKSKIDALL 277
Query: 144 SEKLSTQRD 152
SEKL+ Q+D
Sbjct: 278 SEKLNLQKD 286
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.314 0.129 0.372
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 64,664,971
Number of Sequences: 539616
Number of extensions: 2582217
Number of successful extensions: 37593
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 132
Number of HSP's successfully gapped in prelim test: 86
Number of HSP's that attempted gapping in prelim test: 30201
Number of HSP's gapped (non-prelim): 6428
length of query: 175
length of database: 191,569,459
effective HSP length: 110
effective length of query: 65
effective length of database: 132,211,699
effective search space: 8593760435
effective search space used: 8593760435
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 57 (26.6 bits)