Citrus Sinensis ID: 030567
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 175 | ||||||
| 225425573 | 336 | PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA | 0.948 | 0.494 | 0.759 | 2e-69 | |
| 147771137 | 336 | hypothetical protein VITISV_034257 [Viti | 0.948 | 0.494 | 0.759 | 2e-69 | |
| 307135970 | 333 | naphthoate synthase [Cucumis melo subsp. | 0.925 | 0.486 | 0.766 | 6e-67 | |
| 255568782 | 335 | Naphthoate synthase, putative [Ricinus c | 0.965 | 0.504 | 0.727 | 1e-66 | |
| 449517563 | 333 | PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA | 0.925 | 0.486 | 0.754 | 5e-66 | |
| 449434935 | 333 | PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA | 0.925 | 0.486 | 0.748 | 7e-65 | |
| 359806589 | 339 | uncharacterized protein LOC100807101 [Gl | 0.965 | 0.498 | 0.686 | 6e-63 | |
| 388495372 | 184 | unknown [Medicago truncatula] | 0.92 | 0.875 | 0.723 | 2e-62 | |
| 259490362 | 336 | uncharacterized protein LOC100304279 [Ze | 0.96 | 0.5 | 0.689 | 4e-62 | |
| 30696431 | 337 | naphthoate synthase [Arabidopsis thalian | 0.965 | 0.501 | 0.687 | 7e-62 |
| >gi|225425573|ref|XP_002267500.1| PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA synthase, peroxisomal [Vitis vinifera] gi|297739062|emb|CBI28551.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 266 bits (681), Expect = 2e-69, Method: Compositional matrix adjust.
Identities = 126/166 (75%), Positives = 143/166 (86%)
Query: 7 SARRRMTAVANHLVPVISSDSNSGFIGLNNASMNDSYHRIHGEVPSHDVVWRIACDESGT 66
+ARRR+ +VA+HL P+ S+ N +G + S DSY R+HGEVP+HDV W ACDESG
Sbjct: 12 NARRRLASVAHHLTPLHSTTPNCSSLGFHTTSAPDSYRRVHGEVPTHDVTWNPACDESGK 71
Query: 67 EFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGT 126
FTDIIYEKAVGE IAKITINRP+RRNAFRP+TVKELIRAFNDARDDSSVGVII TGKGT
Sbjct: 72 AFTDIIYEKAVGEAIAKITINRPERRNAFRPNTVKELIRAFNDARDDSSVGVIIFTGKGT 131
Query: 127 EAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMV 172
+AFCSGGDQA R RDGYAD+++FGRLNVLDLQ+QIRRLPKPVIAMV
Sbjct: 132 KAFCSGGDQAFRGRDGYADHDDFGRLNVLDLQMQIRRLPKPVIAMV 177
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147771137|emb|CAN74179.1| hypothetical protein VITISV_034257 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|307135970|gb|ADN33829.1| naphthoate synthase [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|255568782|ref|XP_002525362.1| Naphthoate synthase, putative [Ricinus communis] gi|223535325|gb|EEF37000.1| Naphthoate synthase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449517563|ref|XP_004165815.1| PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA synthase, peroxisomal-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449434935|ref|XP_004135251.1| PREDICTED: 1,4-Dihydroxy-2-naphthoyl-CoA synthase, peroxisomal-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359806589|ref|NP_001241269.1| uncharacterized protein LOC100807101 [Glycine max] gi|255639630|gb|ACU20109.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388495372|gb|AFK35752.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|259490362|ref|NP_001159194.1| uncharacterized protein LOC100304279 [Zea mays] gi|223942561|gb|ACN25364.1| unknown [Zea mays] gi|414881113|tpg|DAA58244.1| TPA: hypothetical protein ZEAMMB73_624046 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|30696431|ref|NP_176255.2| naphthoate synthase [Arabidopsis thaliana] gi|327488386|sp|Q8GYN9.2|MENB_ARATH RecName: Full=1,4-Dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; Short=DHNS; AltName: Full=Enoyl-CoA hydratase/isomerase D; Short=ECHID; AltName: Full=Naphthoate synthase gi|192571726|gb|ACF04808.1| At1g60550 [Arabidopsis thaliana] gi|332195575|gb|AEE33696.1| naphthoate synthase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 175 | ||||||
| TAIR|locus:2036626 | 337 | ECHID "enoyl-CoA hydratase/iso | 0.965 | 0.501 | 0.687 | 9.3e-59 | |
| UNIPROTKB|P0ABU0 | 285 | menB [Escherichia coli K-12 (t | 0.645 | 0.396 | 0.605 | 1.5e-28 | |
| TIGR_CMR|BA_5109 | 272 | BA_5109 "naphthoate synthase" | 0.588 | 0.378 | 0.638 | 5e-28 | |
| UNIPROTKB|P23966 | 271 | menB "1,4-Dihydroxy-2-naphthoy | 0.588 | 0.380 | 0.6 | 4.5e-27 | |
| UNIPROTKB|Q9KQM5 | 296 | VC_1973 "Naphthoate synthase" | 0.645 | 0.381 | 0.588 | 1.2e-26 | |
| TIGR_CMR|VC_1973 | 296 | VC_1973 "naphthoate synthase" | 0.645 | 0.381 | 0.588 | 1.2e-26 | |
| UNIPROTKB|O06414 | 314 | menB "1,4-Dihydroxy-2-naphthoy | 0.657 | 0.366 | 0.421 | 1.3e-20 | |
| TIGR_CMR|SO_4739 | 300 | SO_4739 "naphthoate synthase" | 0.622 | 0.363 | 0.479 | 2.1e-20 | |
| UNIPROTKB|A0QRD3 | 309 | menB "1,4-Dihydroxy-2-naphthoy | 0.611 | 0.346 | 0.448 | 1.4e-18 | |
| TIGR_CMR|CHY_1293 | 257 | CHY_1293 "3-hydroxybutyryl-CoA | 0.577 | 0.392 | 0.333 | 4.4e-10 |
| TAIR|locus:2036626 ECHID "enoyl-CoA hydratase/isomerase D" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 603 (217.3 bits), Expect = 9.3e-59, P = 9.3e-59
Identities = 119/173 (68%), Positives = 143/173 (82%)
Query: 4 QIDSARRRMTAVANHLVPVISSDSNSGFIGLNNAS-MNDSYHRIHGEVPSHDVVWR---I 59
++ SA RR++ V NHL+P+ S + + + L +AS M+D +H++HGEVP+H+VVW+
Sbjct: 6 ELGSASRRLSVVTNHLIPIGFSPARADSVELCSASSMDDRFHKVHGEVPTHEVVWKKTDF 65
Query: 60 ACDESGTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVI 119
+ EF DIIYEKA+ EGIAKITINRP+RRNAFRP TVKEL+RAFNDARDDSSVGVI
Sbjct: 66 FGEGDNKEFVDIIYEKALDEGIAKITINRPERRNAFRPQTVKELMRAFNDARDDSSVGVI 125
Query: 120 ILTGKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMV 172
ILTGKGT+AFCSGGDQALRT+DGYAD + GRLNVLDLQVQIRRLPKPVIAMV
Sbjct: 126 ILTGKGTKAFCSGGDQALRTQDGYADPNDVGRLNVLDLQVQIRRLPKPVIAMV 178
|
|
| UNIPROTKB|P0ABU0 menB [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_5109 BA_5109 "naphthoate synthase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P23966 menB "1,4-Dihydroxy-2-naphthoyl-CoA synthase" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KQM5 VC_1973 "Naphthoate synthase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_1973 VC_1973 "naphthoate synthase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O06414 menB "1,4-Dihydroxy-2-naphthoyl-CoA synthase" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_4739 SO_4739 "naphthoate synthase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A0QRD3 menB "1,4-Dihydroxy-2-naphthoyl-CoA synthase" [Mycobacterium smegmatis str. MC2 155 (taxid:246196)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1293 CHY_1293 "3-hydroxybutyryl-CoA dehydratase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 175 | |||
| PLN02921 | 327 | PLN02921, PLN02921, naphthoate synthase | 2e-97 | |
| PRK07396 | 273 | PRK07396, PRK07396, dihydroxynaphthoic acid synthe | 2e-63 | |
| COG0447 | 282 | COG0447, MenB, Dihydroxynaphthoic acid synthase [C | 4e-52 | |
| TIGR01929 | 259 | TIGR01929, menB, naphthoate synthase (dihydroxynap | 5e-47 | |
| PRK08321 | 302 | PRK08321, PRK08321, naphthoate synthase; Validated | 4e-40 | |
| TIGR03210 | 256 | TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hyd | 2e-27 | |
| cd06558 | 195 | cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme | 6e-26 | |
| pfam00378 | 245 | pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami | 2e-22 | |
| COG1024 | 257 | COG1024, CaiD, Enoyl-CoA hydratase/carnithine race | 5e-22 | |
| PRK05995 | 262 | PRK05995, PRK05995, enoyl-CoA hydratase; Provision | 1e-19 | |
| PRK06688 | 259 | PRK06688, PRK06688, enoyl-CoA hydratase; Provision | 9e-18 | |
| PRK08260 | 296 | PRK08260, PRK08260, enoyl-CoA hydratase; Provision | 1e-15 | |
| PRK08139 | 266 | PRK08139, PRK08139, enoyl-CoA hydratase; Validated | 2e-14 | |
| PRK08290 | 288 | PRK08290, PRK08290, enoyl-CoA hydratase; Provision | 2e-14 | |
| PRK05809 | 260 | PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata | 4e-14 | |
| PRK06210 | 272 | PRK06210, PRK06210, enoyl-CoA hydratase; Provision | 2e-13 | |
| PRK07511 | 260 | PRK07511, PRK07511, enoyl-CoA hydratase; Provision | 1e-12 | |
| PRK06494 | 259 | PRK06494, PRK06494, enoyl-CoA hydratase; Provision | 2e-12 | |
| PRK08140 | 262 | PRK08140, PRK08140, enoyl-CoA hydratase; Provision | 3e-12 | |
| PRK08272 | 302 | PRK08272, PRK08272, enoyl-CoA hydratase; Provision | 5e-12 | |
| PRK09120 | 275 | PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydrata | 6e-12 | |
| PRK06144 | 262 | PRK06144, PRK06144, enoyl-CoA hydratase; Provision | 6e-12 | |
| PRK07468 | 262 | PRK07468, PRK07468, enoyl-CoA hydratase; Provision | 7e-12 | |
| PLN02888 | 265 | PLN02888, PLN02888, enoyl-CoA hydratase | 1e-11 | |
| PRK07657 | 260 | PRK07657, PRK07657, enoyl-CoA hydratase; Provision | 1e-11 | |
| PRK06142 | 272 | PRK06142, PRK06142, enoyl-CoA hydratase; Provision | 3e-11 | |
| PRK05870 | 249 | PRK05870, PRK05870, enoyl-CoA hydratase; Provision | 8e-11 | |
| PRK07854 | 243 | PRK07854, PRK07854, enoyl-CoA hydratase; Provision | 9e-11 | |
| PRK08258 | 277 | PRK08258, PRK08258, enoyl-CoA hydratase; Provision | 9e-11 | |
| PRK07827 | 260 | PRK07827, PRK07827, enoyl-CoA hydratase; Provision | 1e-10 | |
| PRK06127 | 269 | PRK06127, PRK06127, enoyl-CoA hydratase; Provision | 1e-10 | |
| PRK09245 | 266 | PRK09245, PRK09245, enoyl-CoA hydratase; Provision | 2e-10 | |
| PRK05980 | 260 | PRK05980, PRK05980, enoyl-CoA hydratase; Provision | 2e-10 | |
| PRK07110 | 249 | PRK07110, PRK07110, polyketide biosynthesis enoyl- | 5e-10 | |
| PRK07509 | 262 | PRK07509, PRK07509, enoyl-CoA hydratase; Provision | 5e-10 | |
| PRK07260 | 255 | PRK07260, PRK07260, enoyl-CoA hydratase; Provision | 6e-10 | |
| PRK06190 | 258 | PRK06190, PRK06190, enoyl-CoA hydratase; Provision | 7e-10 | |
| TIGR03200 | 360 | TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-car | 2e-09 | |
| PRK05617 | 342 | PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrol | 2e-09 | |
| PRK05864 | 276 | PRK05864, PRK05864, enoyl-CoA hydratase; Provision | 2e-09 | |
| PRK08138 | 261 | PRK08138, PRK08138, enoyl-CoA hydratase; Provision | 7e-09 | |
| PRK07658 | 257 | PRK07658, PRK07658, enoyl-CoA hydratase; Provision | 1e-08 | |
| PRK06072 | 248 | PRK06072, PRK06072, enoyl-CoA hydratase; Provision | 2e-08 | |
| PRK07327 | 268 | PRK07327, PRK07327, enoyl-CoA hydratase; Provision | 2e-08 | |
| PRK05674 | 265 | PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydr | 2e-08 | |
| TIGR02280 | 256 | TIGR02280, PaaB1, phenylacetate degradation probab | 2e-08 | |
| PRK07799 | 263 | PRK07799, PRK07799, enoyl-CoA hydratase; Provision | 3e-08 | |
| PRK03580 | 261 | PRK03580, PRK03580, carnitinyl-CoA dehydratase; Pr | 4e-08 | |
| PRK07659 | 260 | PRK07659, PRK07659, enoyl-CoA hydratase; Provision | 6e-08 | |
| PRK12478 | 298 | PRK12478, PRK12478, enoyl-CoA hydratase; Provision | 7e-08 | |
| PRK08259 | 254 | PRK08259, PRK08259, enoyl-CoA hydratase; Provision | 9e-08 | |
| PLN02988 | 381 | PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrol | 2e-07 | |
| PRK05862 | 257 | PRK05862, PRK05862, enoyl-CoA hydratase; Provision | 3e-07 | |
| PLN02664 | 275 | PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-d | 4e-07 | |
| PRK08150 | 255 | PRK08150, PRK08150, enoyl-CoA hydratase; Provision | 5e-07 | |
| PRK05981 | 266 | PRK05981, PRK05981, enoyl-CoA hydratase; Provision | 5e-07 | |
| PRK08252 | 254 | PRK08252, PRK08252, enoyl-CoA hydratase; Provision | 7e-07 | |
| PRK06495 | 257 | PRK06495, PRK06495, enoyl-CoA hydratase; Provision | 1e-06 | |
| PRK06563 | 255 | PRK06563, PRK06563, enoyl-CoA hydratase; Provision | 2e-06 | |
| PRK11423 | 261 | PRK11423, PRK11423, methylmalonyl-CoA decarboxylas | 2e-06 | |
| PRK09674 | 255 | PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; | 4e-06 | |
| PRK11154 | 708 | PRK11154, fadJ, multifunctional fatty acid oxidati | 2e-05 | |
| PLN02157 | 401 | PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrol | 3e-05 | |
| PLN02874 | 379 | PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrol | 6e-05 | |
| PRK07938 | 249 | PRK07938, PRK07938, enoyl-CoA hydratase; Provision | 1e-04 | |
| PLN02600 | 251 | PLN02600, PLN02600, enoyl-CoA hydratase | 1e-04 | |
| PLN02851 | 407 | PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrol | 2e-04 | |
| TIGR02437 | 714 | TIGR02437, FadB, fatty oxidation complex, alpha su | 0.004 |
| >gnl|CDD|178509 PLN02921, PLN02921, naphthoate synthase | Back alignment and domain information |
|---|
Score = 284 bits (728), Expect = 2e-97
Identities = 120/167 (71%), Positives = 135/167 (80%)
Query: 6 DSARRRMTAVANHLVPVISSDSNSGFIGLNNASMNDSYHRIHGEVPSHDVVWRIACDESG 65
D+ARRR+ VANHLVP + S + + + DSY R+HG+V S VVWR D SG
Sbjct: 2 DAARRRLARVANHLVPSANPASMAAARSSSATAPPDSYRRVHGDVSSEPVVWRKVPDGSG 61
Query: 66 TEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKG 125
EFTDIIYEKAVGEGIAKITINRP+RRNAFRP TVKEL RAFNDARDDSSVGVIILTGKG
Sbjct: 62 KEFTDIIYEKAVGEGIAKITINRPERRNAFRPRTVKELQRAFNDARDDSSVGVIILTGKG 121
Query: 126 TEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMV 172
T+AFCSGGDQA+R +DGY ++ GRLNVLDLQ+QIRRLPKPVIAMV
Sbjct: 122 TKAFCSGGDQAVRGKDGYVGPDDAGRLNVLDLQIQIRRLPKPVIAMV 168
|
Length = 327 |
| >gnl|CDD|180958 PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223524 COG0447, MenB, Dihydroxynaphthoic acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|200143 TIGR01929, menB, naphthoate synthase (dihydroxynaphthoic acid synthetase) | Back alignment and domain information |
|---|
| >gnl|CDD|181386 PRK08321, PRK08321, naphthoate synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|132254 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family | Back alignment and domain information |
|---|
| >gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235664 PRK05995, PRK05995, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236206 PRK08260, PRK08260, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181249 PRK08139, PRK08139, enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236220 PRK08290, PRK08290, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180472 PRK06210, PRK06210, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181009 PRK07511, PRK07511, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236163 PRK08140, PRK08140, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236213 PRK08272, PRK08272, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236383 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydratase/lyase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180424 PRK06144, PRK06144, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180987 PRK07468, PRK07468, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215480 PLN02888, PLN02888, enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >gnl|CDD|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235714 PRK06142, PRK06142, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180298 PRK05870, PRK05870, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236115 PRK07854, PRK07854, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181329 PRK08258, PRK08258, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236109 PRK07827, PRK07827, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235705 PRK06127, PRK06127, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181723 PRK09245, PRK09245, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180335 PRK05980, PRK05980, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235936 PRK07110, PRK07110, polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181008 PRK07509, PRK07509, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180910 PRK07260, PRK07260, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235733 PRK06190, PRK06190, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132244 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|235533 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168278 PRK05864, PRK05864, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236162 PRK08138, PRK08138, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168377 PRK06072, PRK06072, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235991 PRK07327, PRK07327, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168168 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|131333 TIGR02280, PaaB1, phenylacetate degradation probable enoyl-CoA hydratase paaB | Back alignment and domain information |
|---|
| >gnl|CDD|181122 PRK07799, PRK07799, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179599 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236073 PRK07659, PRK07659, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183548 PRK12478, PRK12478, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236205 PRK08259, PRK08259, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178568 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|180295 PRK05862, PRK05862, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178269 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|181254 PRK08150, PRK08150, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235661 PRK05981, PRK05981, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181325 PRK08252, PRK08252, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168580 PRK06495, PRK06495, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180625 PRK06563, PRK06563, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236908 PRK11423, PRK11423, methylmalonyl-CoA decarboxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182026 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236864 PRK11154, fadJ, multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177817 PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|178462 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|181174 PRK07938, PRK07938, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178210 PLN02600, PLN02600, enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >gnl|CDD|178443 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| PLN02921 | 327 | naphthoate synthase | 100.0 | |
| COG0447 | 282 | MenB Dihydroxynaphthoic acid synthase [Coenzyme me | 99.9 | |
| PRK07396 | 273 | dihydroxynaphthoic acid synthetase; Validated | 99.9 | |
| PRK06143 | 256 | enoyl-CoA hydratase; Provisional | 99.9 | |
| PRK05809 | 260 | 3-hydroxybutyryl-CoA dehydratase; Validated | 99.9 | |
| PRK06144 | 262 | enoyl-CoA hydratase; Provisional | 99.9 | |
| TIGR03210 | 256 | badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb | 99.9 | |
| PRK05674 | 265 | gamma-carboxygeranoyl-CoA hydratase; Validated | 99.9 | |
| PRK05995 | 262 | enoyl-CoA hydratase; Provisional | 99.9 | |
| COG1024 | 257 | CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi | 99.9 | |
| PRK06142 | 272 | enoyl-CoA hydratase; Provisional | 99.9 | |
| TIGR01929 | 259 | menB naphthoate synthase (dihydroxynaphthoic acid | 99.9 | |
| PRK09120 | 275 | p-hydroxycinnamoyl CoA hydratase/lyase; Validated | 99.9 | |
| PRK05870 | 249 | enoyl-CoA hydratase; Provisional | 99.9 | |
| PRK08139 | 266 | enoyl-CoA hydratase; Validated | 99.9 | |
| PRK05981 | 266 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK05980 | 260 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK12478 | 298 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK07468 | 262 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK05862 | 257 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK06190 | 258 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK07657 | 260 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK08140 | 262 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK07327 | 268 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK05864 | 276 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK08290 | 288 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK06495 | 257 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PLN02851 | 407 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 99.89 | |
| PRK08272 | 302 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK06563 | 255 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK06127 | 269 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK09674 | 255 | enoyl-CoA hydratase-isomerase; Provisional | 99.89 | |
| PRK06210 | 272 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK09076 | 258 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK07260 | 255 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK07659 | 260 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK07799 | 263 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK07658 | 257 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PRK07827 | 260 | enoyl-CoA hydratase; Provisional | 99.89 | |
| PLN02664 | 275 | enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA | 99.89 | |
| PLN02600 | 251 | enoyl-CoA hydratase | 99.89 | |
| PRK06072 | 248 | enoyl-CoA hydratase; Provisional | 99.88 | |
| PRK08260 | 296 | enoyl-CoA hydratase; Provisional | 99.88 | |
| PRK08258 | 277 | enoyl-CoA hydratase; Provisional | 99.88 | |
| PRK07509 | 262 | enoyl-CoA hydratase; Provisional | 99.88 | |
| KOG1680 | 290 | consensus Enoyl-CoA hydratase [Lipid transport and | 99.88 | |
| PRK08138 | 261 | enoyl-CoA hydratase; Provisional | 99.88 | |
| PRK11423 | 261 | methylmalonyl-CoA decarboxylase; Provisional | 99.88 | |
| PRK06023 | 251 | enoyl-CoA hydratase; Provisional | 99.88 | |
| PRK06688 | 259 | enoyl-CoA hydratase; Provisional | 99.88 | |
| PRK06494 | 259 | enoyl-CoA hydratase; Provisional | 99.88 | |
| PRK09245 | 266 | enoyl-CoA hydratase; Provisional | 99.88 | |
| PRK08150 | 255 | enoyl-CoA hydratase; Provisional | 99.88 | |
| PRK05869 | 222 | enoyl-CoA hydratase; Validated | 99.88 | |
| PRK08321 | 302 | naphthoate synthase; Validated | 99.88 | |
| TIGR02280 | 256 | PaaB1 phenylacetate degradation probable enoyl-CoA | 99.88 | |
| PRK07511 | 260 | enoyl-CoA hydratase; Provisional | 99.88 | |
| PLN02157 | 401 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 99.88 | |
| PRK07938 | 249 | enoyl-CoA hydratase; Provisional | 99.88 | |
| PRK07110 | 249 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 99.87 | |
| PLN02888 | 265 | enoyl-CoA hydratase | 99.87 | |
| PLN02874 | 379 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 99.87 | |
| PRK07112 | 255 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 99.87 | |
| PRK05617 | 342 | 3-hydroxyisobutyryl-CoA hydrolase; Provisional | 99.87 | |
| TIGR03189 | 251 | dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy | 99.87 | |
| PRK08259 | 254 | enoyl-CoA hydratase; Provisional | 99.87 | |
| PRK03580 | 261 | carnitinyl-CoA dehydratase; Provisional | 99.86 | |
| PLN02988 | 381 | 3-hydroxyisobutyryl-CoA hydrolase | 99.86 | |
| PRK08252 | 254 | enoyl-CoA hydratase; Provisional | 99.86 | |
| PRK07854 | 243 | enoyl-CoA hydratase; Provisional | 99.86 | |
| KOG1681 | 292 | consensus Enoyl-CoA isomerase [Lipid transport and | 99.85 | |
| PF00378 | 245 | ECH: Enoyl-CoA hydratase/isomerase family; InterPr | 99.85 | |
| PLN03214 | 278 | probable enoyl-CoA hydratase/isomerase; Provisiona | 99.85 | |
| PRK08788 | 287 | enoyl-CoA hydratase; Validated | 99.84 | |
| PLN02267 | 239 | enoyl-CoA hydratase/isomerase family protein | 99.84 | |
| TIGR03200 | 360 | dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy | 99.83 | |
| PRK06213 | 229 | enoyl-CoA hydratase; Provisional | 99.83 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 99.83 | |
| cd06558 | 195 | crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy | 99.82 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 99.81 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 99.81 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 99.81 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 99.8 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 99.8 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 99.8 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 99.8 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 99.79 | |
| KOG1684 | 401 | consensus Enoyl-CoA hydratase [Lipid transport and | 99.75 | |
| KOG0016 | 266 | consensus Enoyl-CoA hydratase/isomerase [Lipid tra | 99.74 | |
| KOG1679 | 291 | consensus Enoyl-CoA hydratase [Lipid transport and | 99.72 | |
| KOG1682 | 287 | consensus Enoyl-CoA isomerase [Lipid transport and | 99.63 | |
| cd07019 | 211 | S49_SppA_1 Signal peptide peptidase A (SppA), a se | 98.66 | |
| cd07014 | 177 | S49_SppA Signal peptide peptidase A. Signal peptid | 98.46 | |
| cd07023 | 208 | S49_Sppa_N_C Signal peptide peptidase A (SppA), a | 98.2 | |
| cd07022 | 214 | S49_Sppa_36K_type Signal peptide peptidase A (SppA | 98.15 | |
| cd07018 | 222 | S49_SppA_67K_type Signal peptide peptidase A (SppA | 97.59 | |
| TIGR00706 | 207 | SppA_dom signal peptide peptidase SppA, 36K type. | 97.58 | |
| cd00394 | 161 | Clp_protease_like Caseinolytic protease (ClpP) is | 97.57 | |
| TIGR00705 | 584 | SppA_67K signal peptide peptidase SppA, 67K type. | 96.56 | |
| KOG1683 | 380 | consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA | 96.52 | |
| cd07020 | 187 | Clp_protease_NfeD_1 Nodulation formation efficienc | 96.41 | |
| cd07021 | 178 | Clp_protease_NfeD_like Nodulation formation effici | 94.61 | |
| COG0074 | 293 | SucD Succinyl-CoA synthetase, alpha subunit [Energ | 91.0 | |
| cd07016 | 160 | S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- | 89.22 | |
| PRK10949 | 618 | protease 4; Provisional | 88.48 | |
| TIGR00705 | 584 | SppA_67K signal peptide peptidase SppA, 67K type. | 88.21 | |
| PF13607 | 138 | Succ_CoA_lig: Succinyl-CoA ligase like flavodoxin | 87.38 | |
| TIGR00237 | 432 | xseA exodeoxyribonuclease VII, large subunit. This | 85.92 | |
| PTZ00187 | 317 | succinyl-CoA synthetase alpha subunit; Provisional | 85.14 | |
| PF02601 | 319 | Exonuc_VII_L: Exonuclease VII, large subunit; Inte | 84.71 | |
| PLN02522 | 608 | ATP citrate (pro-S)-lyase | 81.9 | |
| PRK10949 | 618 | protease 4; Provisional | 80.8 |
| >PLN02921 naphthoate synthase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-34 Score=242.49 Aligned_cols=171 Identities=70% Similarity=1.041 Sum_probs=139.5
Q ss_pred hHHHHHHHHHhhhccccCCcCCCCCCcccccCCCCCCccccccCCCccccchhhhhccCCCCCcccEEEEEEeCCCEEEE
Q 030567 5 IDSARRRMTAVANHLVPVISSDSNSGFIGLNNASMNDSYHRIHGEVPSHDVVWRIACDESGTEFTDIIYEKAVGEGIAKI 84 (175)
Q Consensus 5 ~~~~~~r~~~i~~hl~~~~~~~~~~~~~~~~~~~~~~sy~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~e~~~~~~V~~I 84 (175)
|+++.||++++++||.+.....+..+....+....+++|++.|+.++.+|..|...++++..+|+.|.++++.+++|++|
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~Va~I 80 (327)
T PLN02921 1 MDAARRRLARVANHLVPSANPASMAAARSSSATAPPDSYRRVHGDVSSEPVVWRKVPDGSGKEFTDIIYEKAVGEGIAKI 80 (327)
T ss_pred CchhhhHHHHHhcccCcccccccccccccccccCCCCchhhhccccCCCCccccccccCCccCCceEEEEEecCCCEEEE
Confidence 78999999999999986644444444333344478899999999999999999998888888999999987335899999
Q ss_pred EEcCCCCCCCCCHHHHHHHHHHHHHhhcCCCceEEEEecCCCCcccCCCCCCccccCCccchhhhhHhhHHHHHHHHhcC
Q 030567 85 TINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRL 164 (175)
Q Consensus 85 tLnrp~~~Nal~~~~~~eL~~al~~~~~d~~vkvvVltG~g~~~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~i~~~ 164 (175)
+||||+++|+|+.+|+.+|.++|+.++.|+++++|||+|.|+++||+|+|++++.................+++.+|.++
T Consensus 81 tLnrP~~~Nal~~~~~~eL~~al~~~~~d~~vrvVVLtg~G~k~FcaG~Dl~~~~~~~~~~~~~~~~~~~~~l~~~l~~~ 160 (327)
T PLN02921 81 TINRPERRNAFRPRTVKELQRAFNDARDDSSVGVIILTGKGTKAFCSGGDQAVRGKDGYVGPDDAGRLNVLDLQIQIRRL 160 (327)
T ss_pred EECCCCCCCCCCHHHHHHHHHHHHHHhhCCCceEEEEecCCCCceecCcChhhhhcccccchhHHHHHHHHHHHHHHHhC
Confidence 99999999999999999999999999999999999999998779999999997753221111111111234567789999
Q ss_pred CCcEEEEeeCC
Q 030567 165 PKPVIAMVHLP 175 (175)
Q Consensus 165 ~kPvIAaV~G~ 175 (175)
+||+||+|||+
T Consensus 161 ~kPvIAaVnG~ 171 (327)
T PLN02921 161 PKPVIAMVAGY 171 (327)
T ss_pred CCCEEEEECCE
Confidence 99999999996
|
|
| >COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07396 dihydroxynaphthoic acid synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06143 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK06144 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase | Back alignment and domain information |
|---|
| >PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK05995 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06142 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) | Back alignment and domain information |
|---|
| >PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated | Back alignment and domain information |
|---|
| >PRK05870 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08139 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK05981 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05980 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK12478 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07468 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05862 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06190 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07657 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08140 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07327 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05864 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08290 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06495 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PRK08272 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06563 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06127 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09674 enoyl-CoA hydratase-isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06210 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09076 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07659 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07799 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07658 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07827 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase | Back alignment and domain information |
|---|
| >PLN02600 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK06072 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08258 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07509 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08138 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK11423 methylmalonyl-CoA decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06023 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06688 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06494 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09245 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08150 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05869 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK08321 naphthoate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB | Back alignment and domain information |
|---|
| >PRK07511 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PRK07938 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PLN02888 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK08259 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK03580 carnitinyl-CoA dehydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02988 3-hydroxyisobutyryl-CoA hydrolase | Back alignment and domain information |
|---|
| >PRK08252 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07854 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix | Back alignment and domain information |
|---|
| >PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK08788 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PLN02267 enoyl-CoA hydratase/isomerase family protein | Back alignment and domain information |
|---|
| >TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase | Back alignment and domain information |
|---|
| >PRK06213 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >KOG1684 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07014 S49_SppA Signal peptide peptidase A | Back alignment and domain information |
|---|
| >cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type | Back alignment and domain information |
|---|
| >cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease | Back alignment and domain information |
|---|
| >TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type | Back alignment and domain information |
|---|
| >KOG1683 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >PRK10949 protease 4; Provisional | Back alignment and domain information |
|---|
| >TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type | Back alignment and domain information |
|---|
| >PF13607 Succ_CoA_lig: Succinyl-CoA ligase like flavodoxin domain; PDB: 2CSU_A | Back alignment and domain information |
|---|
| >TIGR00237 xseA exodeoxyribonuclease VII, large subunit | Back alignment and domain information |
|---|
| >PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 | Back alignment and domain information |
|---|
| >PLN02522 ATP citrate (pro-S)-lyase | Back alignment and domain information |
|---|
| >PRK10949 protease 4; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 175 | ||||
| 2iex_A | 272 | Crystal Structure Of Dihydroxynapthoic Acid Synthet | 1e-31 | ||
| 4els_A | 285 | Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Co | 2e-30 | ||
| 3t88_A | 289 | Crystal Structure Of Escherichia Coli Menb In Compl | 2e-30 | ||
| 3h02_A | 288 | 2.15 Angstrom Resolution Crystal Structure Of Napht | 1e-29 | ||
| 2uzf_A | 273 | Crystal Structure Of Staphylococcus Aureus 1,4-Dihy | 4e-29 | ||
| 4eml_A | 275 | Synechocystis Sp. Pcc 6803 1,4-Dihydroxy-2-Naphthoy | 2e-27 | ||
| 1rjm_A | 339 | Crystal Structure Of Menb (rv0548c) From Mycobacter | 5e-22 | ||
| 3t8a_A | 334 | Crystal Structure Of Mycobacterium Tuberculosis Men | 6e-22 | ||
| 1q51_A | 314 | Crystal Structure Of Mycobacterium Tuberculosis Men | 6e-22 | ||
| 3tlf_A | 274 | Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS | 3e-10 | ||
| 3myb_A | 286 | Crystal Structure Of Enoyl-Coa Hydratase Mycobacter | 9e-10 | ||
| 3he2_A | 264 | Crystal Structure Of Enoyl-Coa Hydratase From Mycob | 3e-08 | ||
| 2vss_F | 276 | Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C | 6e-08 | ||
| 2vsu_F | 276 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 6e-08 | ||
| 2j5i_A | 276 | Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase | 1e-07 | ||
| 2j5i_I | 276 | Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase | 1e-07 | ||
| 2vsu_A | 276 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 1e-07 | ||
| 2j5i_B | 276 | Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase | 1e-07 | ||
| 2vsu_C | 275 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 1e-07 | ||
| 2vsu_E | 276 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 1e-07 | ||
| 2vss_E | 276 | Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C | 1e-07 | ||
| 1jxz_A | 269 | Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coe | 1e-07 | ||
| 4f47_A | 278 | The Structure Of Enoyl-Coa Hydratase Echa19 From My | 3e-07 | ||
| 1uiy_A | 253 | Crystal Structure Of Enoyl-Coa Hydratase From Therm | 3e-07 | ||
| 3qre_A | 298 | Crystal Structure Of An Enoyl-Coa Hydratase Echa12_ | 3e-07 | ||
| 3i47_A | 268 | Crystal Structure Of Putative Enoyl Coa HydrataseIS | 3e-07 | ||
| 3p5m_A | 255 | Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS | 5e-07 | ||
| 1nzy_A | 269 | 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo | 5e-07 | ||
| 1nzy_B | 269 | 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo | 5e-07 | ||
| 1dub_A | 261 | 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph | 9e-07 | ||
| 1mj3_A | 260 | Crystal Structure Analysis Of Rat Enoyl-Coa Hydrata | 3e-06 | ||
| 1ey3_A | 258 | Structure Of Enoyl-Coa Hydratase Complexed With The | 3e-06 | ||
| 2hw5_A | 286 | The Crystal Structure Of Human Enoyl-Coenzyme A (Co | 4e-06 | ||
| 3rsi_A | 265 | The Structure Of A Putative Enoyl-Coa HydrataseISOM | 4e-06 | ||
| 3t3w_A | 279 | Crystal Structure Of Probable Enoyl-Coa Hydratase F | 5e-06 | ||
| 3r0o_A | 273 | Crystal Structure Of Carnitinyl-Coa Hydratase From | 5e-06 | ||
| 3ome_A | 282 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 5e-06 | ||
| 2ej5_A | 257 | Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydr | 5e-06 | ||
| 4fzw_C | 274 | Crystal Structure Of The Paaf-paag Hydratase-isomer | 1e-05 | ||
| 3qmj_A | 256 | Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 Fr | 1e-05 | ||
| 2f6q_A | 280 | The Crystal Structure Of Human Peroxisomal Delta3, | 1e-05 | ||
| 4hdt_A | 353 | Crystal Structure Of A Carnitinyl-Coa Dehydratase F | 2e-05 | ||
| 3r9t_A | 267 | Structure Of Echa1_1 From Mycobacterium Paratubercu | 2e-05 | ||
| 3r9s_A | 267 | Structure Of A Carnitinyl-Coa Dehydratase From Myco | 3e-05 | ||
| 2q35_A | 243 | Crystal Structure Of The Y82f Variant Of Ech2 Decar | 5e-05 | ||
| 3oc7_A | 267 | Crystal Structure Of An Enoyl-Coa Hydratase From My | 8e-05 | ||
| 3kqf_A | 265 | 1.8 Angstrom Resolution Crystal Structure Of Enoyl- | 1e-04 | ||
| 4j2u_A | 365 | Crystal Structure Of An Enoyl-coa Hydratase From Rh | 1e-04 | ||
| 2vre_A | 296 | Crystal Structure Of Human Peroxisomal Delta3,5, De | 1e-04 | ||
| 3swx_A | 265 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 2e-04 | ||
| 3qxz_A | 265 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 2e-04 | ||
| 3bpt_A | 363 | Crystal Structure Of Human Beta-Hydroxyisobutyryl-C | 2e-04 | ||
| 2q2x_A | 243 | Crystal Structure Of The Ech2 Decarboxylase Domain | 2e-04 | ||
| 3qka_A | 261 | Crystal Structure Of Enoyl-Coa Hydratase Echa5 From | 2e-04 | ||
| 3njb_A | 333 | Crystal Structure Of Enoyl-Coa Hydratase From Mycob | 2e-04 | ||
| 3sll_A | 290 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 2e-04 | ||
| 1dci_A | 275 | Dienoyl-Coa Isomerase Length = 275 | 3e-04 | ||
| 3h81_A | 278 | Crystal Structure Of Enoyl-Coa Hydratase From Mycob | 4e-04 | ||
| 3q0j_A | 258 | Crystal Structure Of The Mycobacterium Tuberculosis | 4e-04 | ||
| 3pzk_A | 257 | Crystal Structure Of The Mycobacterium Tuberculosis | 4e-04 | ||
| 3qyr_A | 253 | Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 M | 4e-04 | ||
| 3p85_A | 270 | Crystal Structure Enoyl-Coa Hydratase From Mycobact | 5e-04 | ||
| 3hrx_A | 254 | Crystal Structure Of Phenylacetic Acid Degradation | 7e-04 |
| >pdb|2IEX|A Chain A, Crystal Structure Of Dihydroxynapthoic Acid Synthetase (Gk2873) From Geobacillus Kaustophilus Hta426 Length = 272 | Back alignment and structure |
|
| >pdb|4ELS|A Chain A, Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Coenzyme A Synthases (Menb) In Complex With Bicarbonate Length = 285 | Back alignment and structure |
| >pdb|3T88|A Chain A, Crystal Structure Of Escherichia Coli Menb In Complex With Substrate Analogue, Osb-Ncoa Length = 289 | Back alignment and structure |
| >pdb|3H02|A Chain A, 2.15 Angstrom Resolution Crystal Structure Of Naphthoate Synthase From Salmonella Typhimurium. Length = 288 | Back alignment and structure |
| >pdb|2UZF|A Chain A, Crystal Structure Of Staphylococcus Aureus 1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In Complex With Acetoacetyl Coa Length = 273 | Back alignment and structure |
| >pdb|4EML|A Chain A, Synechocystis Sp. Pcc 6803 1,4-Dihydroxy-2-Naphthoyl-Coenzyme A Synthase (Menb) In Complex With Bicarbonate Length = 275 | Back alignment and structure |
| >pdb|1RJM|A Chain A, Crystal Structure Of Menb (rv0548c) From Mycobacterium Tuberculosis Length = 339 | Back alignment and structure |
| >pdb|3T8A|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Menb In Complex With Substrate Analogue, Osb-Ncoa Length = 334 | Back alignment and structure |
| >pdb|1Q51|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Menb In Complex With Acetoacetyl-Coenzyme A, A Key Enzyme In Vitamin K2 Biosynthesis Length = 314 | Back alignment and structure |
| >pdb|3TLF|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 274 | Back alignment and structure |
| >pdb|3MYB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Mycobacterium Smegm Length = 286 | Back alignment and structure |
| >pdb|3HE2|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 264 | Back alignment and structure |
| >pdb|2VSS|F Chain F, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 | Back alignment and structure |
| >pdb|2VSU|F Chain F, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 | Back alignment and structure |
| >pdb|2J5I|A Chain A, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 | Back alignment and structure |
| >pdb|2J5I|I Chain I, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 | Back alignment and structure |
| >pdb|2VSU|A Chain A, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism. Length = 276 | Back alignment and structure |
| >pdb|2J5I|B Chain B, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 | Back alignment and structure |
| >pdb|2VSU|C Chain C, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 275 | Back alignment and structure |
| >pdb|2VSU|E Chain E, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 | Back alignment and structure |
| >pdb|2VSS|E Chain E, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 | Back alignment and structure |
| >pdb|1JXZ|A Chain A, Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coenzyme A Dehalogenase Complexed With 4-Hydroxybenzoyl-Coenzyme A (Product) Length = 269 | Back alignment and structure |
| >pdb|4F47|A Chain A, The Structure Of Enoyl-Coa Hydratase Echa19 From Mycobacterium Marinum Length = 278 | Back alignment and structure |
| >pdb|1UIY|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Thermus Thermophilus Hb8 Length = 253 | Back alignment and structure |
| >pdb|3QRE|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase Echa12_1 From Mycobacterium Marinum Length = 298 | Back alignment and structure |
| >pdb|3I47|A Chain A, Crystal Structure Of Putative Enoyl Coa HydrataseISOMERASE (Crotonase) From Legionella Pneumophila Subsp. Pneumophila Str. Philadelphia 1 Length = 268 | Back alignment and structure |
| >pdb|3P5M|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Avium Length = 255 | Back alignment and structure |
| >pdb|1NZY|A Chain A, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 | Back alignment and structure |
| >pdb|1NZY|B Chain B, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 | Back alignment and structure |
| >pdb|1DUB|A Chain A, 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 6.5 Length = 261 | Back alignment and structure |
| >pdb|1MJ3|A Chain A, Crystal Structure Analysis Of Rat Enoyl-Coa Hydratase In Complex With Hexadienoyl-Coa Length = 260 | Back alignment and structure |
| >pdb|1EY3|A Chain A, Structure Of Enoyl-Coa Hydratase Complexed With The Substrate Dac-Coa Length = 258 | Back alignment and structure |
| >pdb|2HW5|A Chain A, The Crystal Structure Of Human Enoyl-Coenzyme A (Coa) Hydratase Short Chain 1, Echs1 Length = 286 | Back alignment and structure |
| >pdb|3RSI|A Chain A, The Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 265 | Back alignment and structure |
| >pdb|3T3W|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycobacterium Thermoresistibile Length = 279 | Back alignment and structure |
| >pdb|3R0O|A Chain A, Crystal Structure Of Carnitinyl-Coa Hydratase From Mycobacterium Avium Length = 273 | Back alignment and structure |
| >pdb|3OME|A Chain A, Crystal Structure Of A Probable Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 282 | Back alignment and structure |
| >pdb|2EJ5|A Chain A, Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydratase Subunit Ii) From Geobacillus Kaustophilus Length = 257 | Back alignment and structure |
| >pdb|4FZW|C Chain C, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 274 | Back alignment and structure |
| >pdb|3QMJ|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 From Mycobacterium Marinum Length = 256 | Back alignment and structure |
| >pdb|2F6Q|A Chain A, The Crystal Structure Of Human Peroxisomal Delta3, Delta2 Enoyl Coa Isomerase (Peci) Length = 280 | Back alignment and structure |
| >pdb|4HDT|A Chain A, Crystal Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Thermoresistibile Length = 353 | Back alignment and structure |
| >pdb|3R9T|A Chain A, Structure Of Echa1_1 From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 267 | Back alignment and structure |
| >pdb|3R9S|A Chain A, Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Avium 104 Length = 267 | Back alignment and structure |
| >pdb|2Q35|A Chain A, Crystal Structure Of The Y82f Variant Of Ech2 Decarboxylase Domain Of Curf From Lyngbya Majuscula Length = 243 | Back alignment and structure |
| >pdb|3OC7|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase From Mycobacterium Avium Length = 267 | Back alignment and structure |
| >pdb|3KQF|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis. Length = 265 | Back alignment and structure |
| >pdb|4J2U|A Chain A, Crystal Structure Of An Enoyl-coa Hydratase From Rhodobacter Sphaeroides 2.4.1 Length = 365 | Back alignment and structure |
| >pdb|2VRE|A Chain A, Crystal Structure Of Human Peroxisomal Delta3,5, Delta2,4-Dienoyl Coa Isomerase Length = 296 | Back alignment and structure |
| >pdb|3SWX|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 | Back alignment and structure |
| >pdb|3QXZ|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 | Back alignment and structure |
| >pdb|3BPT|A Chain A, Crystal Structure Of Human Beta-Hydroxyisobutyryl-Coa Hydrolase In Complex With Quercetin Length = 363 | Back alignment and structure |
| >pdb|2Q2X|A Chain A, Crystal Structure Of The Ech2 Decarboxylase Domain Of Curf From Lyngbya Majuscula Length = 243 | Back alignment and structure |
| >pdb|3QKA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa5 From Mycobacterium Marinum Length = 261 | Back alignment and structure |
| >pdb|3NJB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis, Iodide Soak Length = 333 | Back alignment and structure |
| >pdb|3SLL|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 290 | Back alignment and structure |
| >pdb|1DCI|A Chain A, Dienoyl-Coa Isomerase Length = 275 | Back alignment and structure |
| >pdb|3H81|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 278 | Back alignment and structure |
| >pdb|3Q0J|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Complex With The Inhibitor Acetoacetylcoa Length = 258 | Back alignment and structure |
| >pdb|3PZK|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Apo Form Length = 257 | Back alignment and structure |
| >pdb|3QYR|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 | Back alignment and structure |
| >pdb|3P85|A Chain A, Crystal Structure Enoyl-Coa Hydratase From Mycobacterium Avium Length = 270 | Back alignment and structure |
| >pdb|3HRX|A Chain A, Crystal Structure Of Phenylacetic Acid Degradation Protein Paag Length = 254 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 175 | |||
| 2uzf_A | 273 | Naphthoate synthase; lyase, menaquinone biosynthes | 8e-54 | |
| 3t89_A | 289 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 3e-52 | |
| 4eml_A | 275 | Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe | 4e-52 | |
| 3t8b_A | 334 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 6e-52 | |
| 3t3w_A | 279 | Probable enoyl-COA hydratase; ssgcid, structural g | 6e-43 | |
| 2j5i_A | 276 | P-hydroxycinnamoyl COA hydratase/lyase; vanillin, | 5e-36 | |
| 1szo_A | 257 | 6-oxocamphor hydrolase; enzyme-product complex; HE | 3e-28 | |
| 3lke_A | 263 | Enoyl-COA hydratase; nysgrc, target 11251J, struct | 3e-28 | |
| 3qmj_A | 256 | Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, | 6e-28 | |
| 3i47_A | 268 | Enoyl COA hydratase/isomerase (crotonase); structu | 8e-28 | |
| 2ej5_A | 257 | Enoyl-COA hydratase subunit II; structural genomic | 1e-27 | |
| 2j5g_A | 263 | ALR4455 protein; enzyme evolution, C-C bond hydrol | 2e-27 | |
| 3njd_A | 333 | Enoyl-COA hydratase; ssgcid, mycobacerium smegmati | 4e-27 | |
| 2a7k_A | 250 | CARB; crotonase, antibiotic, beta-lactam, biosynth | 4e-27 | |
| 3kqf_A | 265 | Enoyl-COA hydratase/isomerase family protein; IDP0 | 5e-27 | |
| 3g64_A | 279 | Putative enoyl-COA hydratase; alpha-beta structure | 5e-27 | |
| 3myb_A | 286 | Enoyl-COA hydratase; ssgcid, struct genomics, seat | 6e-27 | |
| 3hp0_A | 267 | Putative polyketide biosynthesis enoyl-COA hydrata | 8e-27 | |
| 3sll_A | 290 | Probable enoyl-COA hydratase/isomerase; structural | 1e-26 | |
| 3gow_A | 254 | PAAG, probable enoyl-COA hydratase; the spiral fol | 1e-26 | |
| 3p5m_A | 255 | Enoyl-COA hydratase/isomerase; seattle structural | 1e-26 | |
| 1nzy_A | 269 | Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen | 1e-26 | |
| 3fdu_A | 266 | Putative enoyl-COA hydratase/isomerase; structural | 5e-26 | |
| 3rrv_A | 276 | Enoyl-COA hydratase/isomerase; structural genomics | 6e-26 | |
| 3swx_A | 265 | Probable enoyl-COA hydratase/isomerase; structural | 7e-26 | |
| 3qk8_A | 272 | Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB | 9e-26 | |
| 3qxz_A | 265 | Enoyl-COA hydratase/isomerase; structural genomics | 9e-26 | |
| 2q35_A | 243 | CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} | 1e-25 | |
| 3r9t_A | 267 | ECHA1_1; ssgcid, seattle structural genomics cente | 1e-25 | |
| 1uiy_A | 253 | Enoyl-COA hydratase; lyase, beta-oxidation, croton | 2e-25 | |
| 3oc7_A | 267 | Enoyl-COA hydratase; seattle structural genomics c | 3e-25 | |
| 3qre_A | 298 | Enoyl-COA hydratase, ECHA12_1; structural genomics | 3e-25 | |
| 3isa_A | 254 | Putative enoyl-COA hydratase/isomerase; structural | 3e-25 | |
| 2f6q_A | 280 | Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis | 4e-25 | |
| 2vx2_A | 287 | Enoyl-COA hydratase domain-containing protein 3; i | 6e-25 | |
| 1hzd_A | 272 | AUH, AU-binding protein/enoyl-COA hydratase; RNA-b | 7e-25 | |
| 2pbp_A | 258 | Enoyl-COA hydratase subunit I; B-oxidation, struct | 9e-25 | |
| 3rsi_A | 265 | Putative enoyl-COA hydratase/isomerase; structural | 2e-24 | |
| 3he2_A | 264 | Enoyl-COA hydratase ECHA6; fatty acid metabolism, | 3e-24 | |
| 3tlf_A | 274 | Enoyl-COA hydratase/isomerase; structural genomics | 3e-24 | |
| 1wz8_A | 264 | Enoyl-COA hydratase; lyase, crotonase, hexamer, st | 5e-24 | |
| 1pjh_A | 280 | Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral | 6e-24 | |
| 3lao_A | 258 | Enoyl-COA hydratase/isomerase; alpha-beta sandwich | 7e-24 | |
| 3gkb_A | 287 | Putative enoyl-COA hydratase; structural genomics, | 1e-23 | |
| 4f47_A | 278 | Enoyl-COA hydratase ECHA19; ssgcid, seattle struct | 1e-23 | |
| 3pe8_A | 256 | Enoyl-COA hydratase; emerald biostructures, struct | 1e-23 | |
| 3moy_A | 263 | Probable enoyl-COA hydratase; ssgcid, seattle stru | 2e-23 | |
| 2ppy_A | 265 | Enoyl-COA hydratase; beta-oxidation, fatty acid me | 2e-23 | |
| 3qxi_A | 265 | Enoyl-COA hydratase ECHA1; structural genomics, se | 3e-23 | |
| 3l3s_A | 263 | Enoyl-COA hydratase/isomerase family protein; crot | 3e-23 | |
| 3hin_A | 275 | Putative 3-hydroxybutyryl-COA dehydratase; structu | 5e-23 | |
| 2gtr_A | 261 | CDY-like, chromodomain Y-like protein; structural | 8e-23 | |
| 1mj3_A | 260 | Enoyl-COA hydratase, mitochondrial; homohexamer, l | 2e-22 | |
| 2fbm_A | 291 | Y chromosome chromodomain protein 1, telomeric IS; | 3e-22 | |
| 3h0u_A | 289 | Putative enoyl-COA hydratase; structural genomics, | 4e-22 | |
| 3h81_A | 278 | Enoyl-COA hydratase ECHA8; niaid, decode, infectio | 5e-22 | |
| 1dci_A | 275 | Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg | 5e-22 | |
| 1ef8_A | 261 | Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc | 1e-21 | |
| 1sg4_A | 260 | 3,2-trans-enoyl-COA isomerase, mitochondrial; crot | 2e-21 | |
| 3r9q_A | 262 | Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome | 3e-21 | |
| 3pea_A | 261 | Enoyl-COA hydratase/isomerase family protein; stru | 4e-21 | |
| 3trr_A | 256 | Probable enoyl-COA hydratase/isomerase; ssgcid, st | 2e-20 | |
| 4di1_A | 277 | Enoyl-COA hydratase ECHA17; structural genomics, s | 7e-20 | |
| 2np9_A | 440 | DPGC; protein inhibitor complex, oxidoreductase; H | 3e-19 | |
| 3r6h_A | 233 | Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m | 3e-18 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 1e-16 | |
| 3ot6_A | 232 | Enoyl-COA hydratase/isomerase family protein; stru | 5e-16 | |
| 3m6n_A | 305 | RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X | 6e-15 | |
| 3bpt_A | 363 | 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet | 3e-14 | |
| 3ju1_A | 407 | Enoyl-COA hydratase/isomerase family protein; alph | 1e-13 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 6e-11 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 2e-10 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 1e-08 |
| >2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 | Back alignment and structure |
|---|
Score = 170 bits (434), Expect = 8e-54
Identities = 66/110 (60%), Positives = 78/110 (70%), Gaps = 2/110 (1%)
Query: 63 ESGTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILT 122
E+ E+ +I YE EGIAK+TINRP+ RNAF P TV E+I AF+ ARDD +V VI+LT
Sbjct: 7 ETLREYDEIKYEFY--EGIAKVTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLT 64
Query: 123 GKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMV 172
G+G AFCSGGDQ R GY + RLNVLDLQ IR +PKPVIAMV
Sbjct: 65 GEGDLAFCSGGDQKKRGHGGYVGEDQIPRLNVLDLQRLIRIIPKPVIAMV 114
|
| >3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 | Back alignment and structure |
|---|
| >4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 | Back alignment and structure |
|---|
| >3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 | Back alignment and structure |
|---|
| >3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279 | Back alignment and structure |
|---|
| >2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 | Back alignment and structure |
|---|
| >1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 | Back alignment and structure |
|---|
| >3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 | Back alignment and structure |
|---|
| >3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 | Back alignment and structure |
|---|
| >3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 | Back alignment and structure |
|---|
| >2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 | Back alignment and structure |
|---|
| >2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 | Back alignment and structure |
|---|
| >3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 | Back alignment and structure |
|---|
| >2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 | Back alignment and structure |
|---|
| >3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 | Back alignment and structure |
|---|
| >3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 | Back alignment and structure |
|---|
| >3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 | Back alignment and structure |
|---|
| >3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267 | Back alignment and structure |
|---|
| >3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 | Back alignment and structure |
|---|
| >3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 | Back alignment and structure |
|---|
| >1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 | Back alignment and structure |
|---|
| >3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 | Back alignment and structure |
|---|
| >3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 | Back alignment and structure |
|---|
| >3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 | Back alignment and structure |
|---|
| >3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 | Back alignment and structure |
|---|
| >3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 | Back alignment and structure |
|---|
| >1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 | Back alignment and structure |
|---|
| >3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267 | Back alignment and structure |
|---|
| >3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 | Back alignment and structure |
|---|
| >3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 | Back alignment and structure |
|---|
| >2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 | Back alignment and structure |
|---|
| >2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Length = 287 | Back alignment and structure |
|---|
| >1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 | Back alignment and structure |
|---|
| >2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 | Back alignment and structure |
|---|
| >3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 | Back alignment and structure |
|---|
| >3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 | Back alignment and structure |
|---|
| >1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 | Back alignment and structure |
|---|
| >1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 | Back alignment and structure |
|---|
| >3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 | Back alignment and structure |
|---|
| >3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 | Back alignment and structure |
|---|
| >4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 | Back alignment and structure |
|---|
| >3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 | Back alignment and structure |
|---|
| >3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 | Back alignment and structure |
|---|
| >2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 | Back alignment and structure |
|---|
| >3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 | Back alignment and structure |
|---|
| >3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 | Back alignment and structure |
|---|
| >3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 | Back alignment and structure |
|---|
| >2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 | Back alignment and structure |
|---|
| >1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 | Back alignment and structure |
|---|
| >2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 | Back alignment and structure |
|---|
| >3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 | Back alignment and structure |
|---|
| >3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 | Back alignment and structure |
|---|
| >1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 | Back alignment and structure |
|---|
| >1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 | Back alignment and structure |
|---|
| >1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260 | Back alignment and structure |
|---|
| >3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 | Back alignment and structure |
|---|
| >3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261 | Back alignment and structure |
|---|
| >3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 | Back alignment and structure |
|---|
| >4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 | Back alignment and structure |
|---|
| >2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 | Back alignment and structure |
|---|
| >3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 | Back alignment and structure |
|---|
| >3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 | Back alignment and structure |
|---|
| >3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 | Back alignment and structure |
|---|
| >3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Length = 363 | Back alignment and structure |
|---|
| >3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Length = 407 | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| 4fzw_C | 274 | 1,2-epoxyphenylacetyl-COA isomerase; structural ge | 99.93 | |
| 3hrx_A | 254 | Probable enoyl-COA hydratase; the spiral fold, the | 99.93 | |
| 4fzw_A | 258 | 2,3-dehydroadipyl-COA hydratase; structural genomi | 99.92 | |
| 3t89_A | 289 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 99.92 | |
| 4hdt_A | 353 | 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti | 99.92 | |
| 3kqf_A | 265 | Enoyl-COA hydratase/isomerase family protein; IDP0 | 99.92 | |
| 3i47_A | 268 | Enoyl COA hydratase/isomerase (crotonase); structu | 99.91 | |
| 3pea_A | 261 | Enoyl-COA hydratase/isomerase family protein; stru | 99.91 | |
| 4eml_A | 275 | Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe | 99.91 | |
| 3t8b_A | 334 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 99.91 | |
| 3t3w_A | 279 | Enoyl-COA hydratase; ssgcid, structural genomics, | 99.91 | |
| 3njd_A | 333 | Enoyl-COA hydratase; ssgcid, mycobacerium smegmati | 99.91 | |
| 2j5g_A | 263 | ALR4455 protein; enzyme evolution, C-C bond hydrol | 99.91 | |
| 3lke_A | 263 | Enoyl-COA hydratase; nysgrc, target 112 structural | 99.91 | |
| 3fdu_A | 266 | Putative enoyl-COA hydratase/isomerase; structural | 99.9 | |
| 3g64_A | 279 | Putative enoyl-COA hydratase; alpha-beta structure | 99.9 | |
| 2vx2_A | 287 | Enoyl-COA hydratase domain-containing protein 3; i | 99.9 | |
| 3myb_A | 286 | Enoyl-COA hydratase; ssgcid, struct genomics, seat | 99.9 | |
| 3hin_A | 275 | Putative 3-hydroxybutyryl-COA dehydratase; structu | 99.9 | |
| 3gow_A | 254 | PAAG, probable enoyl-COA hydratase; the spiral fol | 99.9 | |
| 3l3s_A | 263 | Enoyl-COA hydratase/isomerase family protein; crot | 99.9 | |
| 3qmj_A | 256 | Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, | 99.9 | |
| 3sll_A | 290 | Probable enoyl-COA hydratase/isomerase; structural | 99.9 | |
| 2a7k_A | 250 | CARB; crotonase, antibiotic, beta-lactam, biosynth | 99.9 | |
| 3hp0_A | 267 | Putative polyketide biosynthesis enoyl-COA hydrata | 99.9 | |
| 1nzy_A | 269 | Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen | 99.9 | |
| 1ef8_A | 261 | Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc | 99.9 | |
| 3moy_A | 263 | Probable enoyl-COA hydratase; ssgcid, seattle stru | 99.9 | |
| 2ej5_A | 257 | Enoyl-COA hydratase subunit II; structural genomic | 99.9 | |
| 1pjh_A | 280 | Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral | 99.9 | |
| 1szo_A | 257 | 6-oxocamphor hydrolase; enzyme-product complex; HE | 99.9 | |
| 3gkb_A | 287 | Putative enoyl-COA hydratase; structural genomics, | 99.9 | |
| 2uzf_A | 273 | Naphthoate synthase; lyase, menaquinone biosynthes | 99.89 | |
| 4di1_A | 277 | Enoyl-COA hydratase ECHA17; structural genomics, s | 99.89 | |
| 3p5m_A | 255 | Enoyl-COA hydratase/isomerase; seattle structural | 99.89 | |
| 2f6q_A | 280 | Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis | 99.89 | |
| 3h81_A | 278 | Enoyl-COA hydratase ECHA8; niaid, decode, infectio | 99.89 | |
| 3qre_A | 298 | Enoyl-COA hydratase, ECHA12_1; structural genomics | 99.89 | |
| 2j5i_A | 276 | P-hydroxycinnamoyl COA hydratase/lyase; vanillin, | 99.89 | |
| 3he2_A | 264 | Enoyl-COA hydratase ECHA6; fatty acid metabolism, | 99.89 | |
| 2pbp_A | 258 | Enoyl-COA hydratase subunit I; B-oxidation, struct | 99.89 | |
| 3isa_A | 254 | Putative enoyl-COA hydratase/isomerase; structural | 99.89 | |
| 3rrv_A | 276 | Enoyl-COA hydratase/isomerase; structural genomics | 99.89 | |
| 3lao_A | 258 | Enoyl-COA hydratase/isomerase; alpha-beta sandwich | 99.89 | |
| 1dci_A | 275 | Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg | 99.89 | |
| 2ppy_A | 265 | Enoyl-COA hydratase; beta-oxidation, fatty acid me | 99.89 | |
| 3qxz_A | 265 | Enoyl-COA hydratase/isomerase; structural genomics | 99.89 | |
| 3tlf_A | 274 | Enoyl-COA hydratase/isomerase; structural genomics | 99.89 | |
| 3oc7_A | 267 | Enoyl-COA hydratase; seattle structural genomics c | 99.88 | |
| 3pe8_A | 256 | Enoyl-COA hydratase; emerald biostructures, struct | 99.88 | |
| 3rsi_A | 265 | Putative enoyl-COA hydratase/isomerase; structural | 99.88 | |
| 3bpt_A | 363 | 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet | 99.88 | |
| 3r9q_A | 262 | Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome | 99.88 | |
| 3r6h_A | 233 | Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m | 99.88 | |
| 3swx_A | 265 | Probable enoyl-COA hydratase/isomerase; structural | 99.88 | |
| 3ju1_A | 407 | Enoyl-COA hydratase/isomerase family protein; alph | 99.88 | |
| 3r9t_A | 267 | ECHA1_1; ssgcid, seattle structural genomics cente | 99.88 | |
| 3qk8_A | 272 | Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB | 99.88 | |
| 1hzd_A | 272 | AUH, AU-binding protein/enoyl-COA hydratase; RNA-b | 99.88 | |
| 3h0u_A | 289 | Putative enoyl-COA hydratase; structural genomics, | 99.88 | |
| 2fbm_A | 291 | Y chromosome chromodomain protein 1, telomeric IS; | 99.88 | |
| 1uiy_A | 253 | Enoyl-COA hydratase; lyase, beta-oxidation, croton | 99.88 | |
| 1wz8_A | 264 | Enoyl-COA hydratase; lyase, crotonase, hexamer, st | 99.87 | |
| 2gtr_A | 261 | CDY-like, chromodomain Y-like protein; structural | 99.87 | |
| 4f47_A | 278 | Enoyl-COA hydratase ECHA19; ssgcid, seattle struct | 99.87 | |
| 1sg4_A | 260 | 3,2-trans-enoyl-COA isomerase, mitochondrial; crot | 99.87 | |
| 2q35_A | 243 | CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} | 99.86 | |
| 3ot6_A | 232 | Enoyl-COA hydratase/isomerase family protein; stru | 99.86 | |
| 3qxi_A | 265 | Enoyl-COA hydratase ECHA1; structural genomics, se | 99.85 | |
| 1mj3_A | 260 | Enoyl-COA hydratase, mitochondrial; homohexamer, l | 99.85 | |
| 3trr_A | 256 | Probable enoyl-COA hydratase/isomerase; ssgcid, st | 99.85 | |
| 2np9_A | 440 | DPGC; protein inhibitor complex, oxidoreductase; H | 99.84 | |
| 3m6n_A | 305 | RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X | 99.83 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 99.82 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 99.82 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 99.79 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 99.77 | |
| 3bf0_A | 593 | Protease 4; bacterial, hydrolase, inner membrane, | 98.63 | |
| 3rst_A | 240 | Signal peptide peptidase SPPA; alpha/beta protein | 98.4 | |
| 3viv_A | 230 | 441AA long hypothetical NFED protein; protein-pept | 97.97 | |
| 2f9y_B | 304 | Acetyl-coenzyme A carboxylase carboxyl transferas | 97.44 | |
| 1y7o_A | 218 | ATP-dependent CLP protease proteolytic subunit; hy | 95.23 | |
| 2f9i_A | 327 | Acetyl-coenzyme A carboxylase carboxyl transferase | 92.96 | |
| 2f9y_A | 339 | Acetyl-COA carboxylase, carboxyltransferase alpha; | 90.67 | |
| 2cby_A | 208 | ATP-dependent CLP protease proteolytic subunit 1; | 90.01 | |
| 1oi7_A | 288 | Succinyl-COA synthetase alpha chain; SCS, ligase, | 86.18 | |
| 2nu8_A | 288 | Succinyl-COA ligase [ADP-forming] subunit alpha; c | 85.38 | |
| 2yv2_A | 297 | Succinyl-COA synthetase alpha chain; COA-binding d | 84.96 | |
| 2yv1_A | 294 | Succinyl-COA ligase [ADP-forming] subunit alpha; C | 82.94 | |
| 2fp4_A | 305 | Succinyl-COA ligase [GDP-forming] alpha-chain, mit | 80.23 |
| >4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
Probab=99.93 E-value=1.1e-25 Score=183.88 Aligned_cols=108 Identities=29% Similarity=0.459 Sum_probs=84.6
Q ss_pred CCCcccEEEEEEeCCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHhhcCCCceEEEEecCCCCcccCCCCCCccccCCcc
Q 030567 65 GTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYA 144 (175)
Q Consensus 65 ~~~~~~v~~e~~~~~~V~~ItLnrp~~~Nal~~~~~~eL~~al~~~~~d~~vkvvVltG~g~~~FcaG~Dl~~~~~~~~~ 144 (175)
+.-++.|.++. ++||++||||||+++|+||.+|+.+|.++++.++.|+++|+|||||.| ++||+|+|++++......
T Consensus 11 GsM~e~il~~~--~~gVa~itlnRP~~~NAl~~~m~~~L~~al~~~~~d~~vr~vVltg~G-~~FcaG~Dl~~~~~~~~~ 87 (274)
T 4fzw_C 11 GSMMEFILSHV--EKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAG-RGFCAGQDLNDRNVDPTG 87 (274)
T ss_dssp -----CEEEEE--ETTEEEEEECCTTTTSCBCHHHHHHHHHHHHHHHHCTTCCEEEEEESS-SCSBCCBCCC--------
T ss_pred ccccccEEEEE--ECCEEEEEEcCcCccCCCCHHHHHHHHHHHHHHHhCCCceEEEEECCC-CceeCCcChHhhhccccc
Confidence 44456688887 899999999999999999999999999999999999999999999999 999999999987543221
Q ss_pred ---chhhhhHhhHHHHHHHHhcCCCcEEEEeeCC
Q 030567 145 ---DYENFGRLNVLDLQVQIRRLPKPVIAMVHLP 175 (175)
Q Consensus 145 ---~~~~~~~~~~~~~~~~i~~~~kPvIAaV~G~ 175 (175)
+........++.++.+|.++|||+||+|||+
T Consensus 88 ~~~~~~~~~~~~~~~l~~~l~~~~kPvIAav~G~ 121 (274)
T 4fzw_C 88 PAPDLGMSVERFYNPLVRRLAKLPKPVICAVNGV 121 (274)
T ss_dssp -CCCHHHHHHHTHHHHHHHHHHCSSCEEEEECSC
T ss_pred cchHHHHHHHHHHHHHHHHHHHCCCCEEEEECCc
Confidence 2222233345678889999999999999996
|
| >3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A | Back alignment and structure |
|---|
| >4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} | Back alignment and structure |
|---|
| >3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A | Back alignment and structure |
|---|
| >3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A | Back alignment and structure |
|---|
| >3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A | Back alignment and structure |
|---|
| >2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D | Back alignment and structure |
|---|
| >3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} | Back alignment and structure |
|---|
| >3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* | Back alignment and structure |
|---|
| >3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* | Back alignment and structure |
|---|
| >1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* | Back alignment and structure |
|---|
| >3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A | Back alignment and structure |
|---|
| >1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A | Back alignment and structure |
|---|
| >3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* | Back alignment and structure |
|---|
| >3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} | Back alignment and structure |
|---|
| >2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* | Back alignment and structure |
|---|
| >3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A | Back alignment and structure |
|---|
| >3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A | Back alignment and structure |
|---|
| >2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A | Back alignment and structure |
|---|
| >3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A | Back alignment and structure |
|---|
| >3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* | Back alignment and structure |
|---|
| >3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A | Back alignment and structure |
|---|
| >3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A | Back alignment and structure |
|---|
| >1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A | Back alignment and structure |
|---|
| >3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A | Back alignment and structure |
|---|
| >4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A | Back alignment and structure |
|---|
| >2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A | Back alignment and structure |
|---|
| >3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* | Back alignment and structure |
|---|
| >3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* | Back alignment and structure |
|---|
| >3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A | Back alignment and structure |
|---|
| >3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A | Back alignment and structure |
|---|
| >2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A | Back alignment and structure |
|---|
| >1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 | Back alignment and structure |
|---|
| >2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* | Back alignment and structure |
|---|
| >2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 175 | ||||
| d1q52a_ | 297 | c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacter | 1e-24 | |
| d1mj3a_ | 260 | c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat | 2e-18 | |
| d1uiya_ | 253 | c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {The | 7e-16 | |
| d1nzya_ | 269 | c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Ps | 4e-15 | |
| d1dcia_ | 275 | c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 | 6e-15 | |
| d2f6qa1 | 245 | c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-C | 4e-13 | |
| d1pjha_ | 266 | c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 | 2e-12 | |
| d1wdka4 | 310 | c.14.1.3 (A:1-310) Fatty oxidation complex alpha s | 5e-12 | |
| d1szoa_ | 249 | c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus | 5e-12 | |
| d1ef8a_ | 261 | c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Esc | 2e-11 | |
| d1hzda_ | 266 | c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [T | 5e-11 | |
| d2fw2a1 | 258 | c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Hum | 8e-11 | |
| d2a7ka1 | 230 | c.14.1.3 (A:1-230) Carbapenem biosynthes protein C | 4e-10 | |
| d1wz8a1 | 263 | c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TT | 4e-10 | |
| d1sg4a1 | 249 | c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-d | 2e-09 |
| >d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 297 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Crotonase-like domain: Naphthoate synthase MenB species: Mycobacterium tuberculosis [TaxId: 1773]
Score = 94.8 bits (234), Expect = 1e-24
Identities = 48/139 (34%), Positives = 66/139 (47%), Gaps = 18/139 (12%)
Query: 51 PSHDVVWRIACDESGTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDA 110
P WR+ + + TDI Y + V + ++ NRP+ RNAFRPHTV EL R + A
Sbjct: 2 PFDAKAWRLV--DGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHA 59
Query: 111 RDDSSVGVIILTGKGTEAFC----------------SGGDQALRTRDGYADYENFGRLNV 154
R VGV++LTG G SG A D GRL++
Sbjct: 60 RMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASGDTADTVDVARAGRLHI 119
Query: 155 LDLQVQIRRLPKPVIAMVH 173
L++Q IR +PK VI +V+
Sbjct: 120 LEVQRLIRFMPKVVICLVN 138
|
| >d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 260 | Back information, alignment and structure |
|---|
| >d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Length = 253 | Back information, alignment and structure |
|---|
| >d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Length = 269 | Back information, alignment and structure |
|---|
| >d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 275 | Back information, alignment and structure |
|---|
| >d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 266 | Back information, alignment and structure |
|---|
| >d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 310 | Back information, alignment and structure |
|---|
| >d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 249 | Back information, alignment and structure |
|---|
| >d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Length = 261 | Back information, alignment and structure |
|---|
| >d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Length = 230 | Back information, alignment and structure |
|---|
| >d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Length = 263 | Back information, alignment and structure |
|---|
| >d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 249 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 175 | |||
| d2a7ka1 | 230 | Carbapenem biosynthes protein CarB {Pectobacterium | 99.91 | |
| d1szoa_ | 249 | 6-oxo camphor hydrolase {Rhodococcus erythropolis | 99.91 | |
| d1pjha_ | 266 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 99.91 | |
| d1nzya_ | 269 | 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., | 99.9 | |
| d1ef8a_ | 261 | Methylmalonyl CoA decarboxylase {Escherichia coli | 99.9 | |
| d1mj3a_ | 260 | Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve | 99.9 | |
| d1sg4a1 | 249 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 99.89 | |
| d1dcia_ | 275 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 99.89 | |
| d2f6qa1 | 245 | Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( | 99.89 | |
| d1wz8a1 | 263 | Probable enoyl-CoA hydratase TTHA0218 {Thermus the | 99.89 | |
| d1q52a_ | 297 | Naphthoate synthase MenB {Mycobacterium tuberculos | 99.89 | |
| d1uiya_ | 253 | Enoyl-CoA hydratase (crotonase) {Thermus thermophi | 99.88 | |
| d1wdka4 | 310 | Fatty oxidation complex alpha subunit, N-terminal | 99.88 | |
| d2fw2a1 | 258 | Chromodomain protein CDY2A {Human (Homo sapiens) [ | 99.87 | |
| d1hzda_ | 266 | AUH protein {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d2csua2 | 161 | Acetate-CoA ligase alpha chain, AcdA, domains 2 an | 83.34 |
| >d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Crotonase-like domain: Carbapenem biosynthes protein CarB species: Pectobacterium carotovorum [TaxId: 554]
Probab=99.91 E-value=1e-24 Score=171.84 Aligned_cols=103 Identities=23% Similarity=0.335 Sum_probs=88.2
Q ss_pred EEEEEeCCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHhhcCCCceEEEEecCCCCcccCCCCCCccccCCccchhhhhH
Q 030567 72 IYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYADYENFGR 151 (175)
Q Consensus 72 ~~e~~~~~~V~~ItLnrp~~~Nal~~~~~~eL~~al~~~~~d~~vkvvVltG~g~~~FcaG~Dl~~~~~~~~~~~~~~~~ 151 (175)
.++.. +++|++||||||+++|+|+.+|+.+|.++++.++.|+++|+|||+|.|+++||+|+|++++.............
T Consensus 2 ~~~~~-~d~I~~itlnrp~~~Nal~~~~~~~l~~~l~~~~~d~~i~~vVl~~~g~~~F~aG~Dl~~~~~~~~~~~~~~~~ 80 (230)
T d2a7ka1 2 VFEEN-SDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVYGGAERSFSAGGDFNEVKQLSRSEDIEEWI 80 (230)
T ss_dssp EEEEE-ETTEEEEEECCSSTTCBCCHHHHHHHHHHHHHHHHCTTCCEEEEECCTTSCSBCBSCHHHHHTC-CHHHHHHHH
T ss_pred EEEEe-cCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHHHhCCcccccceeccchhhhhhhcccccccccccccccccch
Confidence 34554 88999999999999999999999999999999999999999999998878999999999987654433333334
Q ss_pred hhHHHHHHHHhcCCCcEEEEeeCC
Q 030567 152 LNVLDLQVQIRRLPKPVIAMVHLP 175 (175)
Q Consensus 152 ~~~~~~~~~i~~~~kPvIAaV~G~ 175 (175)
..+++++.++.++|||+||+|||+
T Consensus 81 ~~~~~~~~~i~~~~kpvIaav~G~ 104 (230)
T d2a7ka1 81 DRVIDLYQAVLNVNKPTIAAVDGY 104 (230)
T ss_dssp HHHHHHHHHHHTCCSCEEEEECSE
T ss_pred hhhhhhhhcccchhcceeeecccc
Confidence 456788999999999999999995
|
| >d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csua2 c.23.4.1 (A:130-290) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|