Query         030577
Match_columns 175
No_of_seqs    130 out of 555
Neff          3.8 
Searched_HMMs 46136
Date          Fri Mar 29 15:50:39 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030577.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030577hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00021 BBOX B-Box-type zinc f  97.9 9.6E-06 2.1E-10   49.6   3.0   38   22-63      2-39  (39)
  2 PF00643 zf-B_box:  B-box zinc   97.6 5.7E-05 1.2E-09   47.5   2.8   41   19-63      2-42  (42)
  3 smart00336 BBOX B-Box-type zin  97.3 0.00025 5.4E-09   43.8   3.0   39   21-63      4-42  (42)
  4 KOG4367 Predicted Zn-finger pr  72.5     1.2 2.6E-05   43.1   0.0   48   21-68    163-214 (699)
  5 KOG0129 Predicted RNA-binding   62.1     3.5 7.5E-05   39.9   0.9   47    9-55    443-497 (520)
  6 KOG1280 Uncharacterized conser  51.4     7.3 0.00016   36.4   1.1   35    5-48      2-40  (381)
  7 PF07975 C1_4:  TFIIH C1-like d  50.4       7 0.00015   26.8   0.6   23   31-53     20-42  (51)
  8 PF07649 C1_3:  C1-like domain;  46.1     7.9 0.00017   22.9   0.3   26   22-52      2-27  (30)
  9 cd02342 ZZ_UBA_plant Zinc fing  34.7      25 0.00055   23.5   1.4   29   22-50      2-34  (43)
 10 TIGR00622 ssl1 transcription f  32.1      38 0.00082   26.7   2.2   33   21-53     56-102 (112)
 11 PF03107 C1_2:  C1 domain;  Int  31.1      27 0.00059   20.8   1.0   26   22-52      2-27  (30)
 12 PF01412 ArfGap:  Putative GTPa  29.9      37 0.00081   25.7   1.8   35   18-53     11-45  (116)
 13 PF04438 zf-HIT:  HIT zinc fing  28.8      26 0.00057   21.3   0.6   22   22-44      4-25  (30)
 14 cd02335 ZZ_ADA2 Zinc finger, Z  26.5      97  0.0021   20.2   3.1   31   22-52      2-36  (49)
 15 cd02249 ZZ Zinc finger, ZZ typ  25.9   1E+02  0.0022   19.7   3.1   30   22-51      2-34  (46)
 16 PF10080 DUF2318:  Predicted me  25.5      32  0.0007   26.4   0.8   31   20-53     35-65  (102)
 17 smart00109 C1 Protein kinase C  24.2      36 0.00077   20.7   0.7   30   20-53     11-40  (49)
 18 PF08271 TF_Zn_Ribbon:  TFIIB z  23.0      68  0.0015   20.2   1.8   30   22-52      2-31  (43)
 19 KOG1428 Inhibitor of type V ad  22.5      20 0.00044   40.0  -1.1   50   19-69   3321-3373(3738)
 20 KOG2177 Predicted E3 ubiquitin  21.2      83  0.0018   24.4   2.3   40   22-66     88-128 (386)
 21 KOG2807 RNA polymerase II tran  20.0      49  0.0011   31.0   0.9   34   20-53    330-366 (378)

No 1  
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=97.93  E-value=9.6e-06  Score=49.62  Aligned_cols=38  Identities=39%  Similarity=0.834  Sum_probs=34.1

Q ss_pred             CcccccCCCceEEecCCCcccccccccCCcCCCCCCCceEec
Q 030577           22 RCDICENAPAFFYCEIDGSSLCLQCDMTVHVGGKRTHGRYLL   63 (175)
Q Consensus        22 lCD~C~~aPA~vyC~aD~A~LC~~CD~~vHsaN~~rH~RvpL   63 (175)
                      +|+.+...++.+||.+|.+.+|..|+...|    +.|.++||
T Consensus         2 ~C~~H~~~~~~~fC~~~~~~iC~~C~~~~H----~~H~~~~i   39 (39)
T cd00021           2 LCDEHGEEPLSLFCETDRALLCVDCDLSVH----SGHRRVPL   39 (39)
T ss_pred             CCCccCCcceEEEeCccChhhhhhcChhhc----CCCCEeeC
Confidence            599999889999999999999999998877    37888875


No 2  
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=97.59  E-value=5.7e-05  Score=47.52  Aligned_cols=41  Identities=27%  Similarity=0.614  Sum_probs=35.4

Q ss_pred             CCCCcccccCCCceEEecCCCcccccccccCCcCCCCCCCceEec
Q 030577           19 DVPRCDICENAPAFFYCEIDGSSLCLQCDMTVHVGGKRTHGRYLL   63 (175)
Q Consensus        19 ~~plCD~C~~aPA~vyC~aD~A~LC~~CD~~vHsaN~~rH~RvpL   63 (175)
                      ....|+.|...++.+||..+...+|..|....|..    |..++|
T Consensus         2 ~~~~C~~H~~~~~~~~C~~C~~~~C~~C~~~~H~~----H~~~~i   42 (42)
T PF00643_consen    2 QEPKCPEHPEEPLSLFCEDCNEPLCSECTVSGHKG----HKIVPI   42 (42)
T ss_dssp             SSSB-SSTTTSBEEEEETTTTEEEEHHHHHTSTTT----SEEEEC
T ss_pred             cCccCccCCccceEEEecCCCCccCccCCCCCCCC----CEEeEC
Confidence            45789999998899999999999999999999854    888775


No 3  
>smart00336 BBOX B-Box-type zinc finger.
Probab=97.30  E-value=0.00025  Score=43.82  Aligned_cols=39  Identities=46%  Similarity=0.883  Sum_probs=33.9

Q ss_pred             CCcccccCCCceEEecCCCcccccccccCCcCCCCCCCceEec
Q 030577           21 PRCDICENAPAFFYCEIDGSSLCLQCDMTVHVGGKRTHGRYLL   63 (175)
Q Consensus        21 plCD~C~~aPA~vyC~aD~A~LC~~CD~~vHsaN~~rH~RvpL   63 (175)
                      ..|..|...++.+||..|.+.+|..|....|    +.|.+++|
T Consensus         4 ~~C~~h~~~~~~~~C~~c~~~iC~~C~~~~H----~~H~~~~l   42 (42)
T smart00336        4 PKCDSHGDEPAEFFCEECGALLCRTCDEAEH----RGHTVVLL   42 (42)
T ss_pred             CcCCCCCCCceEEECCCCCcccccccChhhc----CCCceecC
Confidence            4799999889999999999999999998766    47877765


No 4  
>KOG4367 consensus Predicted Zn-finger protein [Function unknown]
Probab=72.47  E-value=1.2  Score=43.09  Aligned_cols=48  Identities=29%  Similarity=0.511  Sum_probs=39.6

Q ss_pred             CCcccccCCC--ceEEecCCCcccccccccCCcCCCC--CCCceEecccccc
Q 030577           21 PRCDICENAP--AFFYCEIDGSSLCLQCDMTVHVGGK--RTHGRYLLLRQRV   68 (175)
Q Consensus        21 plCD~C~~aP--A~vyC~aD~A~LC~~CD~~vHsaN~--~rH~RvpL~~~~~   68 (175)
                      ..|..|+.+|  |.|+|+.+..+.|.-|..+.|-+-.  .+|.-+|-..-++
T Consensus       163 ~kcqlce~a~k~a~v~ceqcdv~yc~pc~~~~hp~rgplakh~l~~~~~grv  214 (699)
T KOG4367|consen  163 LKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRV  214 (699)
T ss_pred             hhhhhhcCChhhhhhhHhhCceEEechHHhccCCCCCchhhcccCCcccCce
Confidence            4799999987  9999999999999999999998754  5787776654443


No 5  
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis]
Probab=62.09  E-value=3.5  Score=39.88  Aligned_cols=47  Identities=26%  Similarity=0.457  Sum_probs=38.3

Q ss_pred             ceecccCCC-CCCCCcccccC-----CCceEEecCCC--cccccccccCCcCCCC
Q 030577            9 HVRVGLANP-SDVPRCDICEN-----APAFFYCEIDG--SSLCLQCDMTVHVGGK   55 (175)
Q Consensus         9 H~Rv~L~~~-~~~plCD~C~~-----aPA~vyC~aD~--A~LC~~CD~~vHsaN~   55 (175)
                      +.||-+.+- -+..+||.|+.     ..|-+||.+-.  -+.|..|=..+|+.-.
T Consensus       443 ~KRVEIkPYv~eDq~CdeC~g~~c~~q~aPfFC~n~~C~QYYCe~CWa~~HS~~~  497 (520)
T KOG0129|consen  443 DKRVEIKPYVMEDQLCDECGGRRCGGQFAPFFCRNATCFQYYCESCWAKIHSGPG  497 (520)
T ss_pred             ceeeeecceeccccchhhhcCeeccCccCCcccCCccHHhhhchHHHHHhhcCCc
Confidence            347777664 48899999999     88999997654  5899999999998743


No 6  
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only]
Probab=51.37  E-value=7.3  Score=36.37  Aligned_cols=35  Identities=34%  Similarity=0.535  Sum_probs=25.8

Q ss_pred             cccCceecccCCCCCCCCcccccCCCceEEecC---C-Cccccccccc
Q 030577            5 LASRHVRVGLANPSDVPRCDICENAPAFFYCEI---D-GSSLCLQCDM   48 (175)
Q Consensus         5 LasRH~Rv~L~~~~~~plCD~C~~aPA~vyC~a---D-~A~LC~~CD~   48 (175)
                      +++||.+|.         ||.|.+..=+++|--   + .--||..|=.
T Consensus         2 ~~~rHe~v~---------CdgC~k~~~t~rrYkCL~C~DyDlC~sCye   40 (381)
T KOG1280|consen    2 LTSRHEGVS---------CDGCGKTAFTFRRYKCLRCSDYDLCFSCYE   40 (381)
T ss_pred             CCCCcCCce---------eccccccceeeeeeEeeeecchhHHHHHhh
Confidence            689999995         999999877777632   2 2357877743


No 7  
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=50.40  E-value=7  Score=26.79  Aligned_cols=23  Identities=22%  Similarity=0.658  Sum_probs=15.7

Q ss_pred             ceEEecCCCcccccccccCCcCC
Q 030577           31 AFFYCEIDGSSLCLQCDMTVHVG   53 (175)
Q Consensus        31 A~vyC~aD~A~LC~~CD~~vHsa   53 (175)
                      ..+.|......+|.+||.-+|..
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~   42 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHET   42 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTT
T ss_pred             CeEECCCCCCccccCcChhhhcc
Confidence            56889999999999999999965


No 8  
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=46.08  E-value=7.9  Score=22.88  Aligned_cols=26  Identities=31%  Similarity=0.613  Sum_probs=8.8

Q ss_pred             CcccccCCCceEEecCCCcccccccccCCcC
Q 030577           22 RCDICENAPAFFYCEIDGSSLCLQCDMTVHV   52 (175)
Q Consensus        22 lCD~C~~aPA~vyC~aD~A~LC~~CD~~vHs   52 (175)
                      .|+.|+..-..     +..+-|..||..+|.
T Consensus         2 ~C~~C~~~~~~-----~~~Y~C~~Cdf~lH~   27 (30)
T PF07649_consen    2 RCDACGKPIDG-----GWFYRCSECDFDLHE   27 (30)
T ss_dssp             --TTTS----S-------EEE-TTT-----H
T ss_pred             cCCcCCCcCCC-----CceEECccCCCccCh
Confidence            48888876432     245678899988884


No 9  
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=34.74  E-value=25  Score=23.51  Aligned_cols=29  Identities=24%  Similarity=0.605  Sum_probs=21.1

Q ss_pred             CcccccCCC---ceEEecCCCc-ccccccccCC
Q 030577           22 RCDICENAP---AFFYCEIDGS-SLCLQCDMTV   50 (175)
Q Consensus        22 lCD~C~~aP---A~vyC~aD~A-~LC~~CD~~v   50 (175)
                      .||.|+..|   ..+.|....- -||..|-.+.
T Consensus         2 ~CDgCg~~PI~G~RykC~~C~dyDLC~~C~~~~   34 (43)
T cd02342           2 QCDGCGVLPITGPRYKSKVKEDYDLCTICFSRM   34 (43)
T ss_pred             CCCCCCCCcccccceEeCCCCCCccHHHHhhhh
Confidence            499999877   5677776554 4999986554


No 10 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=32.12  E-value=38  Score=26.72  Aligned_cols=33  Identities=24%  Similarity=0.590  Sum_probs=26.9

Q ss_pred             CCcccccCCC--------------ceEEecCCCcccccccccCCcCC
Q 030577           21 PRCDICENAP--------------AFFYCEIDGSSLCLQCDMTVHVG   53 (175)
Q Consensus        21 plCD~C~~aP--------------A~vyC~aD~A~LC~~CD~~vHsa   53 (175)
                      ..|-.|+..-              ....|....-.+|.+||.-+|..
T Consensus        56 ~~C~~C~~~f~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fiHe~  102 (112)
T TIGR00622        56 RFCFGCQGPFPKPPVSPFDELKDSHRYVCAVCKNVFCVDCDVFVHES  102 (112)
T ss_pred             CcccCcCCCCCCcccccccccccccceeCCCCCCccccccchhhhhh
Confidence            3599998731              34779999999999999999974


No 11 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=31.12  E-value=27  Score=20.75  Aligned_cols=26  Identities=38%  Similarity=0.824  Sum_probs=18.4

Q ss_pred             CcccccCCCceEEecCCCcccccccccCCcC
Q 030577           22 RCDICENAPAFFYCEIDGSSLCLQCDMTVHV   52 (175)
Q Consensus        22 lCD~C~~aPA~vyC~aD~A~LC~~CD~~vHs   52 (175)
                      .|++|+.....++     .+-|..|+..+|.
T Consensus         2 ~C~~C~~~~~~~~-----~Y~C~~c~f~lh~   27 (30)
T PF03107_consen    2 WCDVCRRKIDGFY-----FYHCSECCFTLHV   27 (30)
T ss_pred             CCCCCCCCcCCCE-----eEEeCCCCCeEcC
Confidence            5899988755543     5777777777774


No 12 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=29.86  E-value=37  Score=25.69  Aligned_cols=35  Identities=23%  Similarity=0.429  Sum_probs=23.5

Q ss_pred             CCCCCcccccCCCceEEecCCCcccccccccCCcCC
Q 030577           18 SDVPRCDICENAPAFFYCEIDGSSLCLQCDMTVHVG   53 (175)
Q Consensus        18 ~~~plCD~C~~aPA~vyC~aD~A~LC~~CD~~vHsa   53 (175)
                      +....|.-|+.....+-+..=+.+||..|= .+|..
T Consensus        11 ~~N~~CaDCg~~~p~w~s~~~GiflC~~Ca-g~HR~   45 (116)
T PF01412_consen   11 PGNKVCADCGAPNPTWASLNYGIFLCLECA-GIHRS   45 (116)
T ss_dssp             TTCTB-TTT-SBS--EEETTTTEEE-HHHH-HHHHH
T ss_pred             cCcCcCCCCCCCCCCEEEeecChhhhHHHH-HHHHH
Confidence            455789999988888888888999999995 44544


No 13 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=28.75  E-value=26  Score=21.30  Aligned_cols=22  Identities=36%  Similarity=0.904  Sum_probs=16.5

Q ss_pred             CcccccCCCceEEecCCCccccc
Q 030577           22 RCDICENAPAFFYCEIDGSSLCL   44 (175)
Q Consensus        22 lCD~C~~aPA~vyC~aD~A~LC~   44 (175)
                      +|.+|+. ++...|....+..|.
T Consensus         4 ~C~vC~~-~~kY~Cp~C~~~~CS   25 (30)
T PF04438_consen    4 LCSVCGN-PAKYRCPRCGARYCS   25 (30)
T ss_dssp             EETSSSS-EESEE-TTT--EESS
T ss_pred             CCccCcC-CCEEECCCcCCceeC
Confidence            6999998 899999998888774


No 14 
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=26.51  E-value=97  Score=20.22  Aligned_cols=31  Identities=26%  Similarity=0.483  Sum_probs=23.5

Q ss_pred             CcccccCCCce---EEecCC-CcccccccccCCcC
Q 030577           22 RCDICENAPAF---FYCEID-GSSLCLQCDMTVHV   52 (175)
Q Consensus        22 lCD~C~~aPA~---vyC~aD-~A~LC~~CD~~vHs   52 (175)
                      .||.|...+-.   +.|... .--||..|=..--.
T Consensus         2 ~Cd~C~~~~~~g~r~~C~~C~d~dLC~~Cf~~g~~   36 (49)
T cd02335           2 HCDYCSKDITGTIRIKCAECPDFDLCLECFSAGAE   36 (49)
T ss_pred             CCCCcCCCCCCCcEEECCCCCCcchhHHhhhCcCC
Confidence            59999987654   888887 56899999765433


No 15 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=25.86  E-value=1e+02  Score=19.71  Aligned_cols=30  Identities=23%  Similarity=0.490  Sum_probs=21.9

Q ss_pred             CcccccCC--CceEEecCCC-cccccccccCCc
Q 030577           22 RCDICENA--PAFFYCEIDG-SSLCLQCDMTVH   51 (175)
Q Consensus        22 lCD~C~~a--PA~vyC~aD~-A~LC~~CD~~vH   51 (175)
                      .|+.|...  ...+.|.... --||..|=...+
T Consensus         2 ~C~~C~~~i~g~r~~C~~C~d~dLC~~Cf~~~~   34 (46)
T cd02249           2 SCDGCLKPIVGVRYHCLVCEDFDLCSSCYAKGK   34 (46)
T ss_pred             CCcCCCCCCcCCEEECCCCCCCcCHHHHHCcCc
Confidence            48888872  2677887776 689999966554


No 16 
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=25.49  E-value=32  Score=26.39  Aligned_cols=31  Identities=23%  Similarity=0.713  Sum_probs=24.2

Q ss_pred             CCCcccccCCCceEEecCCCcccccccccCCcCC
Q 030577           20 VPRCDICENAPAFFYCEIDGSSLCLQCDMTVHVG   53 (175)
Q Consensus        20 ~plCD~C~~aPA~vyC~aD~A~LC~~CD~~vHsa   53 (175)
                      ...|++|+  +..+| ..+....|..|+.+.+..
T Consensus        35 ~daCeiC~--~~GY~-q~g~~lvC~~C~~~~~~~   65 (102)
T PF10080_consen   35 FDACEICG--PKGYY-QEGDQLVCKNCGVRFNLP   65 (102)
T ss_pred             EEeccccC--CCceE-EECCEEEEecCCCEEehh
Confidence            36799994  55566 888889999999887754


No 17 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=24.16  E-value=36  Score=20.73  Aligned_cols=30  Identities=17%  Similarity=0.399  Sum_probs=22.5

Q ss_pred             CCCcccccCCCceEEecCCCcccccccccCCcCC
Q 030577           20 VPRCDICENAPAFFYCEIDGSSLCLQCDMTVHVG   53 (175)
Q Consensus        20 ~plCD~C~~aPA~vyC~aD~A~LC~~CD~~vHsa   53 (175)
                      ...|+.|...-..+.    .+.-|..|...+|..
T Consensus        11 ~~~C~~C~~~i~~~~----~~~~C~~C~~~~H~~   40 (49)
T smart00109       11 PTKCCVCRKSIWGSF----QGLRCSWCKVKCHKK   40 (49)
T ss_pred             CCCccccccccCcCC----CCcCCCCCCchHHHH
Confidence            447999998654433    478899999999964


No 18 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=22.96  E-value=68  Score=20.24  Aligned_cols=30  Identities=17%  Similarity=0.578  Sum_probs=23.2

Q ss_pred             CcccccCCCceEEecCCCcccccccccCCcC
Q 030577           22 RCDICENAPAFFYCEIDGSSLCLQCDMTVHV   52 (175)
Q Consensus        22 lCD~C~~aPA~vyC~aD~A~LC~~CD~~vHs   52 (175)
                      .|..|.... .++-.+..-..|..|..-+..
T Consensus         2 ~Cp~Cg~~~-~~~D~~~g~~vC~~CG~Vl~e   31 (43)
T PF08271_consen    2 KCPNCGSKE-IVFDPERGELVCPNCGLVLEE   31 (43)
T ss_dssp             SBTTTSSSE-EEEETTTTEEEETTT-BBEE-
T ss_pred             CCcCCcCCc-eEEcCCCCeEECCCCCCEeec
Confidence            588999876 888888888999999876654


No 19 
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]
Probab=22.48  E-value=20  Score=39.96  Aligned_cols=50  Identities=28%  Similarity=0.689  Sum_probs=38.4

Q ss_pred             CCCCcccccC--CCceEEecCCCcccccccccCCcCCCC-CCCceEeccccccc
Q 030577           19 DVPRCDICEN--APAFFYCEIDGSSLCLQCDMTVHVGGK-RTHGRYLLLRQRVE   69 (175)
Q Consensus        19 ~~plCD~C~~--aPA~vyC~aD~A~LC~~CD~~vHsaN~-~rH~RvpL~~~~~~   69 (175)
                      -.|+||.-..  -.|.|+|..+. .||.+||.-.|-.-. +.|+|.-+.+-.+.
T Consensus      3321 Q~PmCdNHDDG~TaA~ilC~~C~-nLCtdC~~~lHLHrrtktH~~q~f~eeeea 3373 (3738)
T KOG1428|consen 3321 QMPMCDNHDDGETAAIILCNVCG-NLCTDCDRFLHLHRRTKTHQRQVFKEEEEA 3373 (3738)
T ss_pred             cCCcccCCCCCceeEEEehhhhh-hhHHHHHHHHHHHhhccchhhhhhhhhhhh
Confidence            3578887754  36899999888 999999998876655 78999887654443


No 20 
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=21.21  E-value=83  Score=24.36  Aligned_cols=40  Identities=28%  Similarity=0.494  Sum_probs=28.3

Q ss_pred             CcccccCCCceEEecCCCcccccccc-cCCcCCCCCCCceEecccc
Q 030577           22 RCDICENAPAFFYCEIDGSSLCLQCD-MTVHVGGKRTHGRYLLLRQ   66 (175)
Q Consensus        22 lCD~C~~aPA~vyC~aD~A~LC~~CD-~~vHsaN~~rH~RvpL~~~   66 (175)
                      +|...... ..+||..|...+|..|. ...|    ..|.-+++..+
T Consensus        88 ~c~~~~~~-~~~~c~~~~~~~c~~c~~~~~h----~~h~~~~~~~~  128 (386)
T KOG2177|consen   88 LCEKHGEE-LKLFCEEDEKLLCVLCRESGEH----RGHPVLPLEEA  128 (386)
T ss_pred             hhhhcCCc-ceEEecccccccCCCCCCcccc----cCCccccHHHH
Confidence            56655554 68999999999999999 4444    34555555544


No 21 
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=20.05  E-value=49  Score=31.01  Aligned_cols=34  Identities=26%  Similarity=0.660  Sum_probs=27.3

Q ss_pred             CCCcccccC---CCceEEecCCCcccccccccCCcCC
Q 030577           20 VPRCDICEN---APAFFYCEIDGSSLCLQCDMTVHVG   53 (175)
Q Consensus        20 ~plCD~C~~---aPA~vyC~aD~A~LC~~CD~~vHsa   53 (175)
                      ...|-.|+.   .-..+.|..+.-.+|.+||.-+|..
T Consensus       330 ~~~Cf~C~~~~~~~~~y~C~~Ck~~FCldCDv~iHes  366 (378)
T KOG2807|consen  330 SRFCFACQGELLSSGRYRCESCKNVFCLDCDVFIHES  366 (378)
T ss_pred             CcceeeeccccCCCCcEEchhccceeeccchHHHHhh
Confidence            345999932   3467899999999999999999965


Done!