Citrus Sinensis ID: 030579


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MAPQIDSARRRMTAVANHLVPVISSDSNSGFIGLNNASMNDSYHRIHGEVPSHDVVWRIACDESGTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMVHLP
ccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccEEEEEEccccccccccHHHHHHHHHHHHHHcccccccEEEEEccccccEEcccccccccccccccccHcccccHHHHHHHHHcccccEEEEEccc
***********MTAVANH************************YHRIHGEVPSHDVVWRIACDESGTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMVHLP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPQIDSARRRMTAVANHLVPVISSDSNSGFIGLNNASMNDSYHRIHGEVPSHDVVWRIACDESGTEFTDIIYEKAVGEGIAKITINRPDRRNAFRPHTVKELIRAFNDARDDSSVGVIILTGKGTEAFCSGGDQALRTRDGYADYENFGRLNVLDLQVQIRRLPKPVIAMVHLP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2UZF, chain A
Confidence level:very confident
Coverage over the Query: 66-175
View the alignment between query and template
View the model in PyMOL
Template: 3H02, chain A
Confidence level:confident
Coverage over the Query: 42-135,150-170
View the alignment between query and template
View the model in PyMOL