BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030605
         (174 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2KT9|A Chain A, Solution Nmr Structure Of Probable 30s Ribosomal Protein
           Psrp-3 (Ycf65-Like Protein) From Synechocystis Sp.
           (Strain Pcc 6803), Northeast Structural Genomics
           Consortium Target Target Sgr46
          Length = 116

 Score = 92.8 bits (229), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 56/73 (76%), Gaps = 1/73 (1%)

Query: 94  LVLKFIWMEKNIGLALDQSIPGYGTIPLSQYFFWPRKDAWEELKTTLESKPWISQKMMII 153
            +LK +W+++N+ +A+DQ I G GT PL+ YFFWPR DAW++LK  LE+K WI++   I 
Sbjct: 10  FILKVLWLDQNVAIAVDQ-IVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRIN 68

Query: 154 LLNQATDIINLWQ 166
           +LNQAT++IN WQ
Sbjct: 69  VLNQATEVINFWQ 81


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.130    0.384 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,999,564
Number of Sequences: 62578
Number of extensions: 124782
Number of successful extensions: 189
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 187
Number of HSP's gapped (non-prelim): 2
length of query: 174
length of database: 14,973,337
effective HSP length: 92
effective length of query: 82
effective length of database: 9,216,161
effective search space: 755725202
effective search space used: 755725202
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)