Citrus Sinensis ID: 030613

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----

MAVPSNLTQFTSLSLNPSRSLSHIPTSNPGLVTANNYYTFSSRTSLSVNGRRRRYGAVSVQAMASSYGSRLEESVKKTVSENPVVVYSKTWCSYSSEVKLLFKRLGVEPLVIELDEMGPQGPQLQKLLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAKSAEN

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHcccccEEEEECcccccHHHHHHHHHHHHcccccccEEEccEEEccHHHHHHHHHccccHHHHHHcccccc

******************************LVTANNYYTFSSR**********************************TVSENPVVVYSKTWCSYSSEVKLLFKRLGVEPLVIELDEMGPQGPQLQKLLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAK****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAVPSNLTQFTSLSLNPSRSLSHIPTSNPGLVTANNYYTFSSRTSLSVNGRRRRYGAVSVQAMASSYGSRLEESVKKTVSENPVVVYSKTWCSYSSEVKLLFKRLGVEPLVIELDEMGPQGPQLQKLLERLTGQHTVPNVFIGGKHIGGCTDTVKLYRKGELEPLLSEAKSAEN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Glutaredoxin-C5, chloroplastic	Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.	probable	Q8GWS0
Monothiol glutaredoxin-S10	May only reduce GSH-thiol disulfides, but not protein disulfides.	probable	Q0J3L4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RHB, chain A
Confidence level:very confident
Coverage over the Query: 69-168
View the alignment between query and template
View the model in PyMOL