BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 030621
(174 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|P0CB19|Y3081_ARATH Uncharacterized protein At3g50808 OS=Arabidopsis thaliana
GN=At3g50808 PE=4 SV=1
Length = 110
Score = 41.6 bits (96), Expect = 0.003, Method: Compositional matrix adjust.
Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 5/63 (7%)
Query: 113 IQKYLDITGVQTYIINSARIVFLNER---PQPRPGKGVTNTCLVCERSL--LDSFTFCSL 167
+ +Y+DI+G+ Y IN IV++N+R R V + C +CE + S FCS+
Sbjct: 1 MSQYMDISGIHLYSINGFPIVYINQRRGNNNHRSRSNVMHKCKICEWEIDAASSALFCSM 60
Query: 168 GCK 170
CK
Sbjct: 61 ECK 63
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.324 0.137 0.437
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 66,303,207
Number of Sequences: 539616
Number of extensions: 2582759
Number of successful extensions: 7270
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 7268
Number of HSP's gapped (non-prelim): 2
length of query: 174
length of database: 191,569,459
effective HSP length: 109
effective length of query: 65
effective length of database: 132,751,315
effective search space: 8628835475
effective search space used: 8628835475
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 57 (26.6 bits)