Query         030621
Match_columns 174
No_of_seqs    122 out of 167
Neff          4.1 
Searched_HMMs 46136
Date          Fri Mar 29 16:31:24 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030621.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030621hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04640 PLATZ:  PLATZ transcri 100.0 2.5E-41 5.5E-46  243.2   5.8   72  100-171     1-72  (72)
  2 PF00643 zf-B_box:  B-box zinc   96.7 0.00039 8.4E-09   43.6   0.2   37   59-99      5-42  (42)
  3 cd00021 BBOX B-Box-type zinc f  95.4    0.01 2.2E-07   36.0   1.7   36   59-98      2-38  (39)
  4 smart00336 BBOX B-Box-type zin  94.5   0.029 6.2E-07   34.4   2.0   35   59-97      5-40  (42)
  5 PF12855 Ecl1:  Life-span regul  91.7   0.038 8.2E-07   36.5  -0.6   26  148-173     6-34  (43)
  6 PF03884 DUF329:  Domain of unk  87.7   0.073 1.6E-06   37.1  -1.8   26  148-173     2-32  (57)
  7 PRK01343 zinc-binding protein;  81.9    0.59 1.3E-05   32.7   0.7   26  148-173     9-35  (57)
  8 PF10013 DUF2256:  Uncharacteri  77.7    0.75 1.6E-05   30.5   0.1   23  148-170     8-39  (42)
  9 PF13240 zinc_ribbon_2:  zinc-r  71.5     1.9   4E-05   24.7   0.7   16  151-166     2-17  (23)
 10 PF09889 DUF2116:  Uncharacteri  71.4     1.3 2.9E-05   31.0   0.1   23  149-171     4-26  (59)
 11 PRK00418 DNA gyrase inhibitor;  71.2     1.4 3.1E-05   31.2   0.2   26  148-173     6-36  (62)
 12 COG3024 Uncharacterized protei  65.6     2.4 5.2E-05   30.5   0.4   25  149-173     8-37  (65)
 13 PF02207 zf-UBR:  Putative zinc  64.3     3.3 7.1E-05   29.0   0.9   34   69-102    10-48  (71)
 14 PF06467 zf-FCS:  MYM-type Zinc  63.1       2 4.3E-05   26.7  -0.4   25  147-171     5-41  (43)
 15 cd02340 ZZ_NBR1_like Zinc fing  61.3     5.1 0.00011   25.9   1.3   27   73-99     15-43  (43)
 16 PF13248 zf-ribbon_3:  zinc-rib  61.1     4.6  0.0001   23.4   1.0   19  148-166     2-20  (26)
 17 KOG4367 Predicted Zn-finger pr  60.3     2.7 5.9E-05   40.5  -0.1   36   57-96    223-260 (699)
 18 COG4338 Uncharacterized protei  55.2     1.1 2.4E-05   30.9  -2.7   24  147-170    11-43  (54)
 19 KOG2177 Predicted E3 ubiquitin  49.4     9.6 0.00021   29.8   1.3   38   59-101    88-127 (386)
 20 smart00396 ZnF_UBR1 Putative z  42.0      28 0.00061   24.5   2.7   30   67-96      8-42  (71)
 21 KOG0006 E3 ubiquitin-protein l  41.4      15 0.00032   34.3   1.4   28   52-79    190-228 (446)
 22 PF04438 zf-HIT:  HIT zinc fing  41.0     8.8 0.00019   23.2  -0.0   21  150-170     4-29  (30)
 23 cd02341 ZZ_ZZZ3 Zinc finger, Z  40.7      17 0.00036   24.2   1.2   27   73-99     16-48  (48)
 24 COG4068 Uncharacterized protei  36.0      12 0.00026   26.8  -0.0   23  148-170     8-30  (64)
 25 PF01412 ArfGap:  Putative GTPa  31.2     8.2 0.00018   29.3  -1.6   50   69-119    10-72  (116)
 26 PF04570 DUF581:  Protein of un  29.8      17 0.00037   25.4  -0.1   25  147-171    15-48  (58)
 27 TIGR00412 redox_disulf_2 small  27.5      92   0.002   21.3   3.3   32  107-139    33-66  (76)
 28 PF08002 DUF1697:  Protein of u  27.0      33 0.00072   26.9   1.1   30  105-135    16-48  (137)
 29 PF12773 DZR:  Double zinc ribb  25.6      31 0.00067   21.9   0.6   13  147-159    11-23  (50)
 30 KOG2807 RNA polymerase II tran  24.7      30 0.00065   32.2   0.5   19   70-88    351-374 (378)
 31 KOG3200 Uncharacterized conser  24.1      26 0.00056   30.3  -0.0   33   21-53     43-75  (224)
 32 KOG4582 Uncharacterized conser  23.9      54  0.0012   28.9   2.0   56   43-101   132-199 (278)
 33 PF06906 DUF1272:  Protein of u  23.6      57  0.0012   23.0   1.6   22  150-171     7-31  (57)
 34 cd02344 ZZ_HERC2 Zinc finger,   23.5      48   0.001   21.9   1.2   26   73-98     16-44  (45)
 35 KOG3362 Predicted BBOX Zn-fing  21.4      58  0.0013   27.1   1.5   49   12-69      6-54  (156)
 36 cd02337 ZZ_CBP Zinc finger, ZZ  20.8      32 0.00069   22.0  -0.1   29   71-99     12-41  (41)
 37 smart00105 ArfGap Putative GTP  20.4      20 0.00043   27.1  -1.3   43   71-114     2-57  (112)
 38 PF08459 UvrC_HhH_N:  UvrC Heli  20.1      18  0.0004   29.4  -1.6   26  116-141    16-41  (155)

No 1  
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=100.00  E-value=2.5e-41  Score=243.18  Aligned_cols=72  Identities=67%  Similarity=1.158  Sum_probs=71.1

Q ss_pred             EeccccceeeecchhhhhcccceeeEEecCcEEEEeeCCCCCCCCCCCCccccccccccCCCCeeeeccccc
Q 030621          100 RRSSYHDVIRVSEIQKYLDITGVQTYIINSARIVFLNERPQPRPGKGVTNTCLVCERSLLDSFTFCSLGCKV  171 (174)
Q Consensus       100 RRssYhdVVRv~DIqkl~D~S~IQtYvINsakVVFLn~RPq~r~~kg~~~~C~~C~R~L~d~~rFCSL~CKv  171 (174)
                      |||||||||||+||||+||||+||||+|||+||||||+|||+++++++++.|++|+|+|+|+|+||||+|||
T Consensus         1 Rr~sY~dVVrv~di~kl~D~s~IQtY~iNs~kVVfLn~Rpq~~~~~~~~~~C~~C~R~L~d~~~fCSl~CKv   72 (72)
T PF04640_consen    1 RRYSYHDVVRVSDIQKLLDCSGIQTYVINSAKVVFLNPRPQSRPSKGSGNICETCHRSLQDPYRFCSLSCKV   72 (72)
T ss_pred             CcccccceEEHHHhHhhccccccEEEEeCCceEEEEccCCcCCCCCCCCCccCCCCCCCCCCCeEEeeeEEC
Confidence            899999999999999999999999999999999999999999999999999999999999999999999997


No 2  
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=96.74  E-value=0.00039  Score=43.64  Aligned_cols=37  Identities=32%  Similarity=0.820  Sum_probs=29.5

Q ss_pred             cccccccCCCCCcceecccCCCCcCCccccc-CCCCCceeEE
Q 030621           59 QCKLHADAHKSECNMYCLDCMNGALCSLCLS-LHRDHRAIQI   99 (174)
Q Consensus        59 ~C~~H~~~~knE~N~FCldC~~~~~C~~Cl~-~H~~HrvlQI   99 (174)
                      .|..|..   .+..+||.+|. .++|..|.. .|++|.++.|
T Consensus         5 ~C~~H~~---~~~~~~C~~C~-~~~C~~C~~~~H~~H~~~~i   42 (42)
T PF00643_consen    5 KCPEHPE---EPLSLFCEDCN-EPLCSECTVSGHKGHKIVPI   42 (42)
T ss_dssp             B-SSTTT---SBEEEEETTTT-EEEEHHHHHTSTTTSEEEEC
T ss_pred             cCccCCc---cceEEEecCCC-CccCccCCCCCCCCCEEeEC
Confidence            5888864   34889999998 899999987 4999987754


No 3  
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=95.37  E-value=0.01  Score=35.99  Aligned_cols=36  Identities=25%  Similarity=0.588  Sum_probs=27.7

Q ss_pred             cccccccCCCCCcceecccCCCCcCCccccc-CCCCCceeE
Q 030621           59 QCKLHADAHKSECNMYCLDCMNGALCSLCLS-LHRDHRAIQ   98 (174)
Q Consensus        59 ~C~~H~~~~knE~N~FCldC~~~~~C~~Cl~-~H~~HrvlQ   98 (174)
                      .|+.|..   +...+||.+|. ..+|..|.. .|++|.++-
T Consensus         2 ~C~~H~~---~~~~~fC~~~~-~~iC~~C~~~~H~~H~~~~   38 (39)
T cd00021           2 LCDEHGE---EPLSLFCETDR-ALLCVDCDLSVHSGHRRVP   38 (39)
T ss_pred             CCCccCC---cceEEEeCccC-hhhhhhcChhhcCCCCEee
Confidence            4777753   24589999998 899999975 688887654


No 4  
>smart00336 BBOX B-Box-type zinc finger.
Probab=94.51  E-value=0.029  Score=34.44  Aligned_cols=35  Identities=31%  Similarity=0.836  Sum_probs=27.5

Q ss_pred             cccccccCCCCCcceecccCCCCcCCccccc-CCCCCcee
Q 030621           59 QCKLHADAHKSECNMYCLDCMNGALCSLCLS-LHRDHRAI   97 (174)
Q Consensus        59 ~C~~H~~~~knE~N~FCldC~~~~~C~~Cl~-~H~~Hrvl   97 (174)
                      .|..|.+   ....+||.+|. ..+|..|.. .|++|+++
T Consensus         5 ~C~~h~~---~~~~~~C~~c~-~~iC~~C~~~~H~~H~~~   40 (42)
T smart00336        5 KCDSHGD---EPAEFFCEECG-ALLCRTCDEAEHRGHTVV   40 (42)
T ss_pred             cCCCCCC---CceEEECCCCC-cccccccChhhcCCCcee
Confidence            4777763   24579999998 899999986 58888765


No 5  
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=91.72  E-value=0.038  Score=36.49  Aligned_cols=26  Identities=27%  Similarity=0.875  Sum_probs=22.9

Q ss_pred             Ccccccccccc---CCCCeeeeccccccC
Q 030621          148 TNTCLVCERSL---LDSFTFCSLGCKVNQ  173 (174)
Q Consensus       148 ~~~C~~C~R~L---~d~~rFCSL~CKv~~  173 (174)
                      .+.|.+|+|.+   .+...|||-.|++.+
T Consensus         6 ~~yC~~Cdk~~~~~~~~~lYCSe~Cr~~D   34 (43)
T PF12855_consen    6 NDYCIVCDKQIDPPDDGSLYCSEECRLKD   34 (43)
T ss_pred             hhHHHHhhccccCCCCCccccCHHHHhHh
Confidence            46799999999   668999999999875


No 6  
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=87.66  E-value=0.073  Score=37.11  Aligned_cols=26  Identities=35%  Similarity=0.756  Sum_probs=16.0

Q ss_pred             CccccccccccCC----CCe-eeeccccccC
Q 030621          148 TNTCLVCERSLLD----SFT-FCSLGCKVNQ  173 (174)
Q Consensus       148 ~~~C~~C~R~L~d----~~r-FCSL~CKv~~  173 (174)
                      +..|-+|++...-    +|+ |||-.||+.+
T Consensus         2 ~v~CP~C~k~~~~~~~n~~rPFCS~RCk~iD   32 (57)
T PF03884_consen    2 TVKCPICGKPVEWSPENPFRPFCSERCKLID   32 (57)
T ss_dssp             EEE-TTT--EEE-SSSSS--SSSSHHHHHHH
T ss_pred             cccCCCCCCeecccCCCCcCCcccHhhcccC
Confidence            3469999998875    665 9999999753


No 7  
>PRK01343 zinc-binding protein; Provisional
Probab=81.95  E-value=0.59  Score=32.72  Aligned_cols=26  Identities=27%  Similarity=0.667  Sum_probs=21.2

Q ss_pred             CccccccccccCCC-CeeeeccccccC
Q 030621          148 TNTCLVCERSLLDS-FTFCSLGCKVNQ  173 (174)
Q Consensus       148 ~~~C~~C~R~L~d~-~rFCSL~CKv~~  173 (174)
                      ...|-+|++..... .-|||-.||..+
T Consensus         9 ~~~CP~C~k~~~~~~rPFCS~RC~~iD   35 (57)
T PRK01343          9 TRPCPECGKPSTREAYPFCSERCRDID   35 (57)
T ss_pred             CCcCCCCCCcCcCCCCcccCHHHhhhh
Confidence            45699999987764 589999999865


No 8  
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=77.66  E-value=0.75  Score=30.50  Aligned_cols=23  Identities=35%  Similarity=0.925  Sum_probs=19.6

Q ss_pred             CccccccccccC---------CCCeeeecccc
Q 030621          148 TNTCLVCERSLL---------DSFTFCSLGCK  170 (174)
Q Consensus       148 ~~~C~~C~R~L~---------d~~rFCSL~CK  170 (174)
                      ..+|.+|+|...         |..+|||-.|.
T Consensus         8 ~K~C~~C~rpf~WRKKW~~~Wd~VkYCS~rCR   39 (42)
T PF10013_consen    8 SKICPVCGRPFTWRKKWARCWDEVKYCSDRCR   39 (42)
T ss_pred             CCcCcccCCcchHHHHHHHhchhhccHHHHhc
Confidence            457999999996         47899999996


No 9  
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=71.49  E-value=1.9  Score=24.73  Aligned_cols=16  Identities=31%  Similarity=0.816  Sum_probs=14.3

Q ss_pred             ccccccccCCCCeeee
Q 030621          151 CLVCERSLLDSFTFCS  166 (174)
Q Consensus       151 C~~C~R~L~d~~rFCS  166 (174)
                      |..|+..+.+...||+
T Consensus         2 Cp~CG~~~~~~~~fC~   17 (23)
T PF13240_consen    2 CPNCGAEIEDDAKFCP   17 (23)
T ss_pred             CcccCCCCCCcCcchh
Confidence            7889999999999986


No 10 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=71.42  E-value=1.3  Score=30.99  Aligned_cols=23  Identities=30%  Similarity=0.788  Sum_probs=20.7

Q ss_pred             ccccccccccCCCCeeeeccccc
Q 030621          149 NTCLVCERSLLDSFTFCSLGCKV  171 (174)
Q Consensus       149 ~~C~~C~R~L~d~~rFCSL~CKv  171 (174)
                      ..|..||..+..+-.|||-.|+-
T Consensus         4 kHC~~CG~~Ip~~~~fCS~~C~~   26 (59)
T PF09889_consen    4 KHCPVCGKPIPPDESFCSPKCRE   26 (59)
T ss_pred             CcCCcCCCcCCcchhhhCHHHHH
Confidence            46999999999989999999974


No 11 
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=71.21  E-value=1.4  Score=31.22  Aligned_cols=26  Identities=31%  Similarity=0.731  Sum_probs=20.5

Q ss_pred             CccccccccccC---C-CC-eeeeccccccC
Q 030621          148 TNTCLVCERSLL---D-SF-TFCSLGCKVNQ  173 (174)
Q Consensus       148 ~~~C~~C~R~L~---d-~~-rFCSL~CKv~~  173 (174)
                      .-.|-+|++...   + +| -|||-.||+.+
T Consensus         6 ~v~CP~C~k~~~w~~~~~~rPFCS~RCk~ID   36 (62)
T PRK00418          6 TVNCPTCGKPVEWGEISPFRPFCSKRCQLID   36 (62)
T ss_pred             cccCCCCCCcccccCCCCcCCcccHHHHhhh
Confidence            456999999874   3 45 79999999864


No 12 
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=65.57  E-value=2.4  Score=30.50  Aligned_cols=25  Identities=28%  Similarity=0.651  Sum_probs=20.1

Q ss_pred             ccccccccccCC----C-CeeeeccccccC
Q 030621          149 NTCLVCERSLLD----S-FTFCSLGCKVNQ  173 (174)
Q Consensus       149 ~~C~~C~R~L~d----~-~rFCSL~CKv~~  173 (174)
                      -.|-+|++...-    + +-|||-.||+-+
T Consensus         8 v~CP~Cgkpv~w~~~s~frPFCSkRCklID   37 (65)
T COG3024           8 VPCPTCGKPVVWGEESPFRPFCSKRCKLID   37 (65)
T ss_pred             ccCCCCCCcccccccCCcCcchhHhhhhcc
Confidence            459999998864    4 479999999864


No 13 
>PF02207 zf-UBR:  Putative zinc finger in N-recognin (UBR box);  InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The N-end rule-based degradation signal, which targets a protein for ubiquitin-dependent proteolysis, comprises a destabilising amino-terminal residue and a specific internal lysine residue. This entry describes a putative zinc finger in N-recognin, a recognition component of the N-end rule pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0004842 ubiquitin-protein ligase activity, 0008270 zinc ion binding; PDB: 3NY1_B 3NIS_F 3NIM_A 3NIK_A 3NII_A 3NIH_A 3NIL_D 3NIN_B 3NIJ_A 3NIT_A ....
Probab=64.31  E-value=3.3  Score=29.01  Aligned_cols=34  Identities=29%  Similarity=0.642  Sum_probs=24.2

Q ss_pred             CCcceecccCCC---CcCCccc-cc-CCCCCceeEEEec
Q 030621           69 SECNMYCLDCMN---GALCSLC-LS-LHRDHRAIQIRRS  102 (174)
Q Consensus        69 nE~N~FCldC~~---~~~C~~C-l~-~H~~HrvlQIRRs  102 (174)
                      ++--..|++|..   .++|..| .. .|.+|++..++-.
T Consensus        10 ~q~~y~C~tC~~~~~~~iC~~CF~~~~H~gH~~~~~~~~   48 (71)
T PF02207_consen   10 GQIFYRCLTCSLDESSGICEECFANSCHEGHRVVYYRSS   48 (71)
T ss_dssp             T-EEEEETTTBSSTT-BBEHHHHCTSGGGGSSEEEEE--
T ss_pred             CCEEEECccCCCCCCEEEchhhCCCCCcCCCcEEEEEeC
Confidence            366788999973   5799999 54 7999998866654


No 14 
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=63.07  E-value=2  Score=26.69  Aligned_cols=25  Identities=28%  Similarity=0.673  Sum_probs=15.8

Q ss_pred             CCccccccccccCC-C-----------Ceeeeccccc
Q 030621          147 VTNTCLVCERSLLD-S-----------FTFCSLGCKV  171 (174)
Q Consensus       147 ~~~~C~~C~R~L~d-~-----------~rFCSL~CKv  171 (174)
                      ....|..|++.+.. +           ..|||.+|.-
T Consensus         5 ~~~~C~~C~~~~~~~~~~~~~~~~g~~~~FCS~~C~~   41 (43)
T PF06467_consen    5 KMKTCSYCKKYIPNKPTMIEVQYDGKMKQFCSQSCLS   41 (43)
T ss_dssp             SCEE-TTT--EEECCC----EE-TTTTSCCSSHHHHH
T ss_pred             cCCcCcccCCcccCCCccccccccCcccChhCHHHHh
Confidence            45689999987743 2           3899999953


No 15 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=61.32  E-value=5.1  Score=25.90  Aligned_cols=27  Identities=33%  Similarity=0.781  Sum_probs=20.8

Q ss_pred             eecccCCCCcCCccccc--CCCCCceeEE
Q 030621           73 MYCLDCMNGALCSLCLS--LHRDHRAIQI   99 (174)
Q Consensus        73 ~FCldC~~~~~C~~Cl~--~H~~HrvlQI   99 (174)
                      .-|+.|.+--+|..|-.  .|..|+.++|
T Consensus        15 y~C~~C~d~dLC~~C~~~~~H~~H~f~~~   43 (43)
T cd02340          15 YKCLVCPDYDLCESCEAKGVHPEHAMLKI   43 (43)
T ss_pred             EECCCCCCccchHHhhCcCCCCCCCEEeC
Confidence            66888877889999965  5777877653


No 16 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=61.08  E-value=4.6  Score=23.36  Aligned_cols=19  Identities=21%  Similarity=0.494  Sum_probs=15.6

Q ss_pred             CccccccccccCCCCeeee
Q 030621          148 TNTCLVCERSLLDSFTFCS  166 (174)
Q Consensus       148 ~~~C~~C~R~L~d~~rFCS  166 (174)
                      ...|..|+..+.+..+||+
T Consensus         2 ~~~Cp~Cg~~~~~~~~fC~   20 (26)
T PF13248_consen    2 EMFCPNCGAEIDPDAKFCP   20 (26)
T ss_pred             cCCCcccCCcCCcccccCh
Confidence            3468899998888899996


No 17 
>KOG4367 consensus Predicted Zn-finger protein [Function unknown]
Probab=60.29  E-value=2.7  Score=40.49  Aligned_cols=36  Identities=31%  Similarity=0.728  Sum_probs=28.1

Q ss_pred             cccccccccCCCCCcceecccCCCCcCCccccc--CCCCCce
Q 030621           57 FVQCKLHADAHKSECNMYCLDCMNGALCSLCLS--LHRDHRA   96 (174)
Q Consensus        57 F~~C~~H~~~~knE~N~FCldC~~~~~C~~Cl~--~H~~Hrv   96 (174)
                      -..|..|+..   ...|||+.|. -++|..|+.  .|..|.|
T Consensus       223 ~~~ct~h~~e---~~smyc~~ck-~pvc~~clee~khs~hev  260 (699)
T KOG4367|consen  223 VSTCTDHELE---NHSMYCVQCK-MPVCYQCLEEGKHSSHEV  260 (699)
T ss_pred             hhhccCCCCC---CceEEEEecC-ChHHHHHHHhhcccchhh
Confidence            4578888753   2569999998 899999997  5777764


No 18 
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.17  E-value=1.1  Score=30.93  Aligned_cols=24  Identities=33%  Similarity=0.881  Sum_probs=20.4

Q ss_pred             CCccccccccccC---------CCCeeeecccc
Q 030621          147 VTNTCLVCERSLL---------DSFTFCSLGCK  170 (174)
Q Consensus       147 ~~~~C~~C~R~L~---------d~~rFCSL~CK  170 (174)
                      ...+|++|+|.+.         |...|||-.|+
T Consensus        11 p~KICpvCqRPFsWRkKW~~cWDeVKyCSeRCr   43 (54)
T COG4338          11 PDKICPVCQRPFSWRKKWARCWDEVKYCSERCR   43 (54)
T ss_pred             chhhhhhhcCchHHHHHHHHHHHHHHHHHHHHH
Confidence            3678999999985         56899999997


No 19 
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=49.39  E-value=9.6  Score=29.76  Aligned_cols=38  Identities=29%  Similarity=0.691  Sum_probs=30.1

Q ss_pred             cccccccCCCCCcceecccCCCCcCCcccc-c-CCCCCceeEEEe
Q 030621           59 QCKLHADAHKSECNMYCLDCMNGALCSLCL-S-LHRDHRAIQIRR  101 (174)
Q Consensus        59 ~C~~H~~~~knE~N~FCldC~~~~~C~~Cl-~-~H~~HrvlQIRR  101 (174)
                      .|..|...    ..+||..|. ..+|..|. . .|.+|+++-+..
T Consensus        88 ~c~~~~~~----~~~~c~~~~-~~~c~~c~~~~~h~~h~~~~~~~  127 (386)
T KOG2177|consen   88 LCEKHGEE----LKLFCEEDE-KLLCVLCRESGEHRGHPVLPLEE  127 (386)
T ss_pred             hhhhcCCc----ceEEecccc-cccCCCCCCcccccCCccccHHH
Confidence            78888653    679999998 78999996 3 799999776553


No 20 
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway. Domain is involved in recognition of N-end rule substrates in yeast Ubr1p
Probab=41.95  E-value=28  Score=24.54  Aligned_cols=30  Identities=30%  Similarity=0.535  Sum_probs=22.5

Q ss_pred             CCCCcceecccCCC---CcCCccccc--CCCCCce
Q 030621           67 HKSECNMYCLDCMN---GALCSLCLS--LHRDHRA   96 (174)
Q Consensus        67 ~knE~N~FCldC~~---~~~C~~Cl~--~H~~Hrv   96 (174)
                      .++|--..|++|..   ..+|..|-.  .|.+|++
T Consensus         8 ~~~~~~y~C~tC~~~~~~~iC~~Cf~~~~H~gH~~   42 (71)
T smart00396        8 TGGEVIYRCKTCGLDPTCVLCSDCFRSNCHKGHDY   42 (71)
T ss_pred             CCCCEEEECcCCCCCCCEeEChHHCCCCCCCCCCE
Confidence            45677788999973   358888865  6999983


No 21 
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones]
Probab=41.36  E-value=15  Score=34.31  Aligned_cols=28  Identities=29%  Similarity=0.755  Sum_probs=23.5

Q ss_pred             hcchhcccccccccCC-----------CCCcceecccCC
Q 030621           52 LQTSFFVQCKLHADAH-----------KSECNMYCLDCM   79 (174)
Q Consensus        52 L~~~FF~~C~~H~~~~-----------knE~N~FCldC~   79 (174)
                      |..+||=.|.+|+++.           .|-+|+-|+.|.
T Consensus       190 ~fAEFfFKC~ah~~~~k~~aa~lhli~~N~~ni~C~~Ct  228 (446)
T KOG0006|consen  190 LFAEFFFKCGAHPTSDKETAAALHLIATNSRNITCITCT  228 (446)
T ss_pred             chHhheehhccCCCccccchhHHHHhhcccccceeEEec
Confidence            6678999999999873           368999999997


No 22 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=40.97  E-value=8.8  Score=23.25  Aligned_cols=21  Identities=33%  Similarity=0.746  Sum_probs=12.5

Q ss_pred             cccccccccC-----CCCeeeecccc
Q 030621          150 TCLVCERSLL-----DSFTFCSLGCK  170 (174)
Q Consensus       150 ~C~~C~R~L~-----d~~rFCSL~CK  170 (174)
                      .|.+|+..-.     -..+||||.|.
T Consensus         4 ~C~vC~~~~kY~Cp~C~~~~CSl~C~   29 (30)
T PF04438_consen    4 LCSVCGNPAKYRCPRCGARYCSLACY   29 (30)
T ss_dssp             EETSSSSEESEE-TTT--EESSHHHH
T ss_pred             CCccCcCCCEEECCCcCCceeCcEeE
Confidence            4677776211     13689999984


No 23 
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=40.75  E-value=17  Score=24.25  Aligned_cols=27  Identities=33%  Similarity=0.751  Sum_probs=19.5

Q ss_pred             eecccCC--CCcCCccccc---CCC-CCceeEE
Q 030621           73 MYCLDCM--NGALCSLCLS---LHR-DHRAIQI   99 (174)
Q Consensus        73 ~FCldC~--~~~~C~~Cl~---~H~-~HrvlQI   99 (174)
                      .-|++|.  +--+|+.|..   .|. +|+++.|
T Consensus        16 ~~C~~C~~~d~DlC~~C~~~~~~H~~~H~~~~i   48 (48)
T cd02341          16 YHCSECDDGDFDLCQDCVVKGESHQEDHWLVKI   48 (48)
T ss_pred             EECCCCCCCCCccCHHHHhCcCCCCCCCceeeC
Confidence            6688888  7789999964   354 5776654


No 24 
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=36.02  E-value=12  Score=26.81  Aligned_cols=23  Identities=26%  Similarity=0.694  Sum_probs=20.5

Q ss_pred             CccccccccccCCCCeeeecccc
Q 030621          148 TNTCLVCERSLLDSFTFCSLGCK  170 (174)
Q Consensus       148 ~~~C~~C~R~L~d~~rFCSL~CK  170 (174)
                      ...|.+|+..+...-+|||-.|.
T Consensus         8 H~HC~VCg~aIp~de~~CSe~C~   30 (64)
T COG4068           8 HRHCVVCGKAIPPDEQVCSEECG   30 (64)
T ss_pred             CccccccCCcCCCccchHHHHHH
Confidence            35799999999998999999996


No 25 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=31.23  E-value=8.2  Score=29.26  Aligned_cols=50  Identities=26%  Similarity=0.384  Sum_probs=29.2

Q ss_pred             CCcceecccCCC-----------CcCCcccccCCCC--CceeEEEeccccceeeecchhhhhcc
Q 030621           69 SECNMYCLDCMN-----------GALCSLCLSLHRD--HRAIQIRRSSYHDVIRVSEIQKYLDI  119 (174)
Q Consensus        69 nE~N~FCldC~~-----------~~~C~~Cl~~H~~--HrvlQIRRssYhdVVRv~DIqkl~D~  119 (174)
                      ..-|..|.||..           .-+|..|...|+.  .++-+| |+.-.|-...+||+.+...
T Consensus        10 ~~~N~~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~lg~~is~V-kSi~~d~w~~~ev~~~~~~   72 (116)
T PF01412_consen   10 KPGNKVCADCGAPNPTWASLNYGIFLCLECAGIHRSLGVHISRV-KSITMDNWSPEEVQRMREG   72 (116)
T ss_dssp             STTCTB-TTT-SBS--EEETTTTEEE-HHHHHHHHHHTTTT--E-EETTTS---HHHHHHHHHS
T ss_pred             CcCcCcCCCCCCCCCCEEEeecChhhhHHHHHHHHHhcccchhc-cccccCCCCHHHHHHHHHH
Confidence            356889999962           2389999877773  223333 6777888888888887655


No 26 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=29.76  E-value=17  Score=25.39  Aligned_cols=25  Identities=32%  Similarity=0.869  Sum_probs=19.3

Q ss_pred             CCccccccccccC---CC--C----eeeeccccc
Q 030621          147 VTNTCLVCERSLL---DS--F----TFCSLGCKV  171 (174)
Q Consensus       147 ~~~~C~~C~R~L~---d~--~----rFCSL~CKv  171 (174)
                      .-..|-.|.|.|.   |-  |    -|||..|.-
T Consensus        15 FL~~C~~C~k~L~~~~DiymYrGd~aFCS~ECR~   48 (58)
T PF04570_consen   15 FLSFCYLCKKKLDPGKDIYMYRGDKAFCSEECRS   48 (58)
T ss_pred             HHHHHHccCCCCCCCCCeeeeccccccccHHHHH
Confidence            4568999999998   32  3    599999964


No 27 
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2. This small protein is found in three archaeal species so far (Methanococcus jannaschii, Archeoglobus fulgidus, and Methanobacterium thermoautotrophicum) as well as in Anabaena PCC7120. It is homologous to thioredoxins, glutaredoxins, and protein disulfide isomerases, and shares with them a redox-active disulfide. The redox active disulfide region CXXC motif resembles neither thioredoxin nor glutaredoxin. A closely related protein found in the same three Archaea, described by redox_disulf_1, has a glutaredoxin-like CP[YH]C sequence; it has been characterized in functional assays as redox-active but unlikely to be a thioredoxin or glutaredoxin.
Probab=27.52  E-value=92  Score=21.34  Aligned_cols=32  Identities=9%  Similarity=0.318  Sum_probs=22.3

Q ss_pred             eeeecchhhh--hcccceeeEEecCcEEEEeeCCC
Q 030621          107 VIRVSEIQKY--LDITGVQTYIINSARIVFLNERP  139 (174)
Q Consensus       107 VVRv~DIqkl--~D~S~IQtYvINsakVVFLn~RP  139 (174)
                      +++++|+...  +++.+|-|.++||..+ +....|
T Consensus        33 ~~~v~~~~~a~~~~v~~vPti~i~G~~~-~~G~~~   66 (76)
T TIGR00412        33 FEKVTDMNEILEAGVTATPGVAVDGELV-IMGKIP   66 (76)
T ss_pred             EEEeCCHHHHHHcCCCcCCEEEECCEEE-EEeccC
Confidence            5666655554  7899999999987655 554444


No 28 
>PF08002 DUF1697:  Protein of unknown function (DUF1697);  InterPro: IPR012545 This family contains many hypothetical bacterial proteins.; PDB: 2HIY_B.
Probab=26.95  E-value=33  Score=26.89  Aligned_cols=30  Identities=37%  Similarity=0.656  Sum_probs=20.1

Q ss_pred             cceeeecchhhh---hcccceeeEEecCcEEEEe
Q 030621          105 HDVIRVSEIQKY---LDITGVQTYIINSARIVFL  135 (174)
Q Consensus       105 hdVVRv~DIqkl---~D~S~IQtYvINsakVVFL  135 (174)
                      ++-|+..|+...   +-..+|+||+ +|.-|||=
T Consensus        16 ~nki~MaeLr~~l~~~Gf~~V~Tyi-~SGNvvf~   48 (137)
T PF08002_consen   16 KNKIKMAELREALEDLGFTNVRTYI-QSGNVVFE   48 (137)
T ss_dssp             BS---HHHHHHHHHHCT-EEEEEET-TTTEEEEE
T ss_pred             CCcccHHHHHHHHHHcCCCCceEEE-eeCCEEEe
Confidence            345666777665   5788999995 88899997


No 29 
>PF12773 DZR:  Double zinc ribbon
Probab=25.59  E-value=31  Score=21.94  Aligned_cols=13  Identities=23%  Similarity=0.414  Sum_probs=9.3

Q ss_pred             CCccccccccccC
Q 030621          147 VTNTCLVCERSLL  159 (174)
Q Consensus       147 ~~~~C~~C~R~L~  159 (174)
                      ....|..|+..|.
T Consensus        11 ~~~fC~~CG~~l~   23 (50)
T PF12773_consen   11 DAKFCPHCGTPLP   23 (50)
T ss_pred             cccCChhhcCChh
Confidence            3567778877777


No 30 
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=24.68  E-value=30  Score=32.21  Aligned_cols=19  Identities=37%  Similarity=0.742  Sum_probs=14.7

Q ss_pred             CcceecccCC-----CCcCCcccc
Q 030621           70 ECNMYCLDCM-----NGALCSLCL   88 (174)
Q Consensus        70 E~N~FCldC~-----~~~~C~~Cl   88 (174)
                      =+|.||+||.     ....|+.|-
T Consensus       351 Ck~~FCldCDv~iHesLh~CpgCe  374 (378)
T KOG2807|consen  351 CKNVFCLDCDVFIHESLHNCPGCE  374 (378)
T ss_pred             ccceeeccchHHHHhhhhcCCCcC
Confidence            3789999995     345899986


No 31 
>KOG3200 consensus Uncharacterized conserved protein [Function unknown]
Probab=24.07  E-value=26  Score=30.30  Aligned_cols=33  Identities=27%  Similarity=0.539  Sum_probs=19.3

Q ss_pred             ccccccccCCCCCCchhhhhcCCCCCcHHHHhc
Q 030621           21 KPKNRRIMGGGGPEEEDEEMSNKWPPWLRPLLQ   53 (174)
Q Consensus        21 ~~~~~~~m~~~~~~~~~~e~~~~~P~WL~~LL~   53 (174)
                      -++|||+-.-||-.-+.--..+..|+||+.+..
T Consensus        43 ~L~NRRLqNyGGvvh~~glipeelP~wLq~~v~   75 (224)
T KOG3200|consen   43 VLANRRLQNYGGVVHKTGLIPEELPPWLQYYVD   75 (224)
T ss_pred             HHHhhhhhhcCCccccCCcCccccCHHHHHHHH
Confidence            367999876333321110112348999999886


No 32 
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only]
Probab=23.95  E-value=54  Score=28.89  Aligned_cols=56  Identities=20%  Similarity=0.341  Sum_probs=36.0

Q ss_pred             CCCCcHHHHhcc-hhc-----c---cccccccCCCCCcceecccCCCCcCCccccc---CCCCCceeEEEe
Q 030621           43 KWPPWLRPLLQT-SFF-----V---QCKLHADAHKSECNMYCLDCMNGALCSLCLS---LHRDHRAIQIRR  101 (174)
Q Consensus        43 ~~P~WL~~LL~~-~FF-----~---~C~~H~~~~knE~N~FCldC~~~~~C~~Cl~---~H~~HrvlQIRR  101 (174)
                      ..+.||++-+.+ -++     .   .|..|+-.+   --.-|+.|.+--||..|-.   .|..|..||+.+
T Consensus       132 ~~~~~~~~~~~~~H~~~~~~~v~CD~C~~~~IvG---~RyKC~~C~dYDLCe~Ce~~~~~h~~H~~lR~~t  199 (278)
T KOG4582|consen  132 SLVITLNPVVGEMHPNISKLSVPCDNCGKPGIVG---ARYKCTVCPDYDLCERCEAGNEHHAAHAMLRLHT  199 (278)
T ss_pred             hhhhhcCCCccccCCCcccccccCCCccCCcccc---ceeeecCCCccchhHHhhcCCCCCcccceeeccc
Confidence            456677665552 233     2   444444321   1267999988889999954   455799999887


No 33 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=23.63  E-value=57  Score=22.98  Aligned_cols=22  Identities=32%  Similarity=0.806  Sum_probs=18.0

Q ss_pred             cccccccccCC-C--Ceeeeccccc
Q 030621          150 TCLVCERSLLD-S--FTFCSLGCKV  171 (174)
Q Consensus       150 ~C~~C~R~L~d-~--~rFCSL~CKv  171 (174)
                      .||.|++.|.- +  .+-||..|-.
T Consensus         7 nCE~C~~dLp~~s~~A~ICSfECTF   31 (57)
T PF06906_consen    7 NCECCDKDLPPDSPEAYICSFECTF   31 (57)
T ss_pred             CccccCCCCCCCCCcceEEeEeCcc
Confidence            59999999975 3  7899998854


No 34 
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=23.53  E-value=48  Score=21.89  Aligned_cols=26  Identities=23%  Similarity=0.576  Sum_probs=19.3

Q ss_pred             eecccCCCCcCCccccc--CCC-CCceeE
Q 030621           73 MYCLDCMNGALCSLCLS--LHR-DHRAIQ   98 (174)
Q Consensus        73 ~FCldC~~~~~C~~Cl~--~H~-~HrvlQ   98 (174)
                      .-|+.|.+--+|..|-.  .|. .|.-+.
T Consensus        16 ykC~~C~dyDLC~~Cf~~~~H~~~H~F~r   44 (45)
T cd02344          16 FKCRNCDDFDFCENCFKTRKHNTRHTFGR   44 (45)
T ss_pred             EECCCCCCccchHHhhCCCCcCCCCceee
Confidence            67999998889999976  453 565443


No 35 
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only]
Probab=21.43  E-value=58  Score=27.05  Aligned_cols=49  Identities=22%  Similarity=0.184  Sum_probs=29.0

Q ss_pred             hhcccccccccccccccCCCCCCchhhhhcCCCCCcHHHHhcchhcccccccccCCCC
Q 030621           12 QELLTVREFKPKNRRIMGGGGPEEEDEEMSNKWPPWLRPLLQTSFFVQCKLHADAHKS   69 (174)
Q Consensus        12 ~~~~~~~~~~~~~~~~m~~~~~~~~~~e~~~~~P~WL~~LL~~~FF~~C~~H~~~~kn   69 (174)
                      ++....|++.++-||.|.-     ..  ..-+.-+=|++|....|-+.  -|.+.-++
T Consensus         6 e~r~s~r~~~~~~rRvlD~-----~a--r~rr~~r~l~~Le~Dn~~dd--pha~l~~~   54 (156)
T KOG3362|consen    6 EERASQRIKDQEQRRVLDL-----NA--RQRRDNRNLEALEQDNFHDD--PHASLVKP   54 (156)
T ss_pred             HHHHHHHHhhhhhccccch-----HH--HHhhhhhhhHHHhhhccCCC--cccccccc
Confidence            3445678888999999841     11  11223456888888776553  45544444


No 36 
>cd02337 ZZ_CBP Zinc finger, ZZ type. Zinc finger present in CBP/p300 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. CREB-binding protein (CBP) is a large multidomain protein that provides binding sites for transcriptional coactivators, the role of the ZZ domain in CBP/p300 is unclear.
Probab=20.75  E-value=32  Score=22.05  Aligned_cols=29  Identities=21%  Similarity=0.515  Sum_probs=21.3

Q ss_pred             cceecccCCCCcCCccccc-CCCCCceeEE
Q 030621           71 CNMYCLDCMNGALCSLCLS-LHRDHRAIQI   99 (174)
Q Consensus        71 ~N~FCldC~~~~~C~~Cl~-~H~~HrvlQI   99 (174)
                      .-+-|..|.+--+|..|.. ..+.|...||
T Consensus        12 ~r~~C~~C~dfDLC~~C~~~~~H~H~~~~~   41 (41)
T cd02337          12 TRWHCTVCEDYDLCITCYNTKNHPHKMEKL   41 (41)
T ss_pred             CceECCCCcchhhHHHHhCCCCCCcccccC
Confidence            4477999987789999986 3446776664


No 37 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=20.40  E-value=20  Score=27.08  Aligned_cols=43  Identities=30%  Similarity=0.457  Sum_probs=26.1

Q ss_pred             cceecccCCC-----------CcCCcccccCCCCC--ceeEEEeccccceeeecchh
Q 030621           71 CNMYCLDCMN-----------GALCSLCLSLHRDH--RAIQIRRSSYHDVIRVSEIQ  114 (174)
Q Consensus        71 ~N~FCldC~~-----------~~~C~~Cl~~H~~H--rvlQIRRssYhdVVRv~DIq  114 (174)
                      -|..|.||..           .-+|..|...|+..  ++-. .|+.-.|...-++|+
T Consensus         2 ~N~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~lg~his~-VkSl~md~w~~~~i~   57 (112)
T smart00105        2 GNKKCFDCGAPNPTWASVNLGVFLCIECSGIHRSLGVHISK-VRSLTLDTWTEEELR   57 (112)
T ss_pred             CCCcccCCCCCCCCcEEeccceeEhHHhHHHHHhcCCCcCe-eeecccCCCCHHHHH
Confidence            3788999962           13788888777753  2222 445555655555554


No 38 
>PF08459 UvrC_HhH_N:  UvrC Helix-hairpin-helix N-terminal;  InterPro: IPR001162 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products []. The UvrC proteins contain 4 conserved regions: a central region which interacts with UvrB (Uvr domain), a Helix hairpin Helix (HhH) domain important for 5 prime incision of damage DNA and the homology regions 1 and 2 of unknown function. UvrC homology region 2 is specific for UvrC proteins, whereas UvrC homology region 1 is also shared by few other nucleases. Proteins that contain the UvrC homology region 1, IPR000305 from INTERPRO, are listed below:   Prokaryotic UvrC proteins.  Bacteriophage T4 END2 protein. Small subunit of ribonucleotide reductase enzyme. T4 TEV1 protein. Endonuclease specific to the thymidylate synthase (td) gene splice junction. Found in putative intron-homing endonucleases encoded by group I introns of fungi and phage. Mycobacterium hypothetical protein Y002. Exonuclease by similarity.  Bacillus subtilis hypothetical protein YURQ.  ; GO: 0003677 DNA binding, 0004518 nuclease activity, 0006289 nucleotide-excision repair; PDB: 3C65_A 2NRZ_A 2NRR_A 2NRX_A 2NRV_A 2NRT_A 2NRW_A.
Probab=20.15  E-value=18  Score=29.43  Aligned_cols=26  Identities=27%  Similarity=0.393  Sum_probs=22.4

Q ss_pred             hhcccceeeEEecCcEEEEeeCCCCC
Q 030621          116 YLDITGVQTYIINSARIVFLNERPQP  141 (174)
Q Consensus       116 l~D~S~IQtYvINsakVVFLn~RPq~  141 (174)
                      .||+|.+|.--.-++-|||.+.+|.+
T Consensus        16 ~fDiSh~~G~~~Vgs~Vvf~~G~~~k   41 (155)
T PF08459_consen   16 CFDISHIQGSDTVGSMVVFENGKPDK   41 (155)
T ss_dssp             EEEEEECTTTCEEEEEEEEETTEE-G
T ss_pred             EEECcccCCcccEEEEEEEECCccCh
Confidence            48999999888889999999988764


Done!