Query         030650
Match_columns 174
No_of_seqs    49 out of 51
Neff          2.9 
Searched_HMMs 46136
Date          Fri Mar 29 02:31:20 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030650.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030650hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05395 DARPP-32:  Protein pho  37.2      39 0.00085   28.7   3.2   54  120-173    30-90  (174)
  2 PF07636 PSRT:  PSRT;  InterPro  12.7      90  0.0019   20.1   0.5   10  115-124    14-23  (32)
  3 COG1454 EutG Alcohol dehydroge  12.2 1.4E+02   0.003   27.6   1.8   19  155-173   355-373 (377)
  4 cd08171 GlyDH-like2 Glycerol d  12.1 1.3E+02  0.0028   26.2   1.5   19  156-174   325-343 (345)
  5 PF03835 Rad4:  Rad4 transgluta  11.5      69  0.0015   24.8  -0.3   20    2-27     79-98  (145)
  6 cd08181 PPD-like 1,3-propanedi  11.0 2.4E+02  0.0051   24.8   2.8   18  156-173   339-356 (357)
  7 PRK09860 putative alcohol dehy  10.8 2.4E+02  0.0051   25.2   2.7   23  151-173   356-379 (383)
  8 cd08189 Fe-ADH5 Iron-containin  10.5 2.6E+02  0.0055   24.7   2.8   23  151-173   350-374 (374)
  9 cd08182 HEPD Hydroxyethylphosp  10.3 2.5E+02  0.0055   24.5   2.7   19  155-173   348-366 (367)
 10 cd08185 Fe-ADH1 Iron-containin  10.1 2.7E+02  0.0059   24.5   2.8   23  151-173   354-379 (380)

No 1  
>PF05395 DARPP-32:  Protein phosphatase inhibitor 1/DARPP-32;  InterPro: IPR008466 This family consists of several mammalian protein phosphatase inhibitor 1 (IPP-1) and dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32) proteins. Protein phosphatase inhibitor-1 is involved in signal transduction and is an endogenous inhibitor of protein phosphatase-1 []. It has been demonstrated that DARPP-32, if phosphorylated, can inhibit protein-phosphatase-1 []. DARPP-32 has a key role in many neurotransmitter pathways throughout the brain and has been shown to be involved in controlling receptors, ion channels and other physiological factors including the brain's response to drugs of abuse, such as cocaine, opiates and nicotine. DARPP-32 is reciprocally regulated by the two neurotransmitters that are most often implicated in schizophrenia - dopamine and glutamate. Dopamine activates DARPP-32 through the D1 receptor pathway and disables DARPP-32 through the D2 receptor. Glutamate, acting through the N-methyl-d-aspartate receptor, renders DARPP-32 inactive. A mutant form of DARPP-32 has been linked with gastric cancers [].; GO: 0004864 protein phosphatase inhibitor activity, 0007165 signal transduction
Probab=37.19  E-value=39  Score=28.73  Aligned_cols=54  Identities=28%  Similarity=0.400  Sum_probs=42.5

Q ss_pred             CCCCCCC-----CCCCCCC--CCCCCCccccccchhHHHHHhhhcCCCCCcCcHHHHHhhc
Q 030650          120 TRRGTPV-----RDQPWPG--RTQQGNPICQGCWILVLRRRLNSMRTPPRTRTKEELKEAY  173 (174)
Q Consensus       120 RrR~sP~-----sDqRWP~--~~~~~nsl~~g~~~~v~r~~~nsm~~~~~~~~~~~~~~~~  173 (174)
                      |||+||-     +||-=|.  ..+.+|.+-.|.+...-+-+.|+..++|-..-...|+|..
T Consensus        30 rRRPTPAtLv~~sd~ssp~~ded~~p~q~~~~~~~~~~~qR~~~~ytpPtmK~vQ~mve~H   90 (174)
T PF05395_consen   30 RRRPTPATLVILSDQSSPEIDEDRSPHQLLKGENQMSPRQRKQSVYTPPTMKAVQRMVEHH   90 (174)
T ss_pred             hcCCCCceeEEecCCCCCccccccCcccccccccccChhhcccccccCcccchhHHHHHhh
Confidence            7778875     8887773  3467778888889899999999999999888777777653


No 2  
>PF07636 PSRT:  PSRT;  InterPro: IPR011504 This motif is found at the N terminus of several short hypothetical proteins in Rhodopirellula baltica and the predicted Arylsulphatase B (3.1.6.12 from EC) Q7UX97 from SWISSPROT.
Probab=12.70  E-value=90  Score=20.13  Aligned_cols=10  Identities=60%  Similarity=0.843  Sum_probs=8.2

Q ss_pred             CCCCCCCCCC
Q 030650          115 KATPETRRGT  124 (174)
Q Consensus       115 k~TPERrR~s  124 (174)
                      .-||||||.+
T Consensus        14 SRTpeRrrS~   23 (32)
T PF07636_consen   14 SRTPERRRST   23 (32)
T ss_pred             CCCccccccc
Confidence            7899999944


No 3  
>COG1454 EutG Alcohol dehydrogenase, class IV [Energy production and conversion]
Probab=12.20  E-value=1.4e+02  Score=27.63  Aligned_cols=19  Identities=42%  Similarity=0.688  Sum_probs=16.8

Q ss_pred             hhcCCCCCcCcHHHHHhhc
Q 030650          155 NSMRTPPRTRTKEELKEAY  173 (174)
Q Consensus       155 nsm~~~~~~~~~~~~~~~~  173 (174)
                      .-+.+|||.-++||+++.|
T Consensus       355 ~~~~~NPr~~t~ed~~~i~  373 (377)
T COG1454         355 PCTATNPRPPTREDIKEIY  373 (377)
T ss_pred             cccCCCCCCCCHHHHHHHH
Confidence            4678999999999999987


No 4  
>cd08171 GlyDH-like2 Glycerol dehydrogenase-like. Glycerol dehydrogenases-like. The proteins in this family have not been characterized, but they show sequence homology with glycerol dehydrogenase. Glycerol dehydrogenases (GlyDH) is a key enzyme in the glycerol dissimilation pathway. In anaerobic conditions, many microorganisms utilize glycerol as a source of carbon through coupled oxidative and reductive pathways. One of the pathways involves the oxidation of glycerol to dihydroxyacetone with the reduction of NAD+ to NADH catalyzed by glycerol dehydrogenases. Dihydroxyacetone is then phosphorylated by dihydroxyacetone kinase and enters the glycolytic pathway for further degradation. The activity of GlyDH is zinc-dependent. The zinc ion plays a role in stabilizing an alkoxide intermediate at the active site.
Probab=12.10  E-value=1.3e+02  Score=26.25  Aligned_cols=19  Identities=32%  Similarity=0.364  Sum_probs=16.2

Q ss_pred             hcCCCCCcCcHHHHHhhcC
Q 030650          156 SMRTPPRTRTKEELKEAYI  174 (174)
Q Consensus       156 sm~~~~~~~~~~~~~~~~~  174 (174)
                      .|.+||+.-|+|+++++|.
T Consensus       325 ~~~~~p~~~t~e~i~~~~~  343 (345)
T cd08171         325 DLKHVPYPVTKEMIAEAIK  343 (345)
T ss_pred             hHhhCCCCCCHHHHHHHHH
Confidence            4567999999999999874


No 5  
>PF03835 Rad4:  Rad4 transglutaminase-like domain;  InterPro: IPR018325 RAD4/Xp-C proteins contain an ancient transglutaminase fold that is also found in peptide-N-glycanases (PNGases), which remove glycans from glycoproteins during their degradation. The PNGases retain the catalytic triad that is typical of this fold and are predicted to have a reaction mechanism similar to that involved in transglutamination. In contrast, the RAD4/Xp-C proteins are predicted to be inactive and are likely to only possess the interaction function in DNA repair []. ; GO: 0003684 damaged DNA binding, 0006289 nucleotide-excision repair, 0005634 nucleus; PDB: 2QSG_A 2QSF_A 2QSH_A 1X3W_A 1X3Z_A 3ESW_A.
Probab=11.52  E-value=69  Score=24.76  Aligned_cols=20  Identities=30%  Similarity=0.456  Sum_probs=12.5

Q ss_pred             eeecCCCCCCCCCCCCccccccccCC
Q 030650            2 VVAISEENPRTRKPKGRFVSSRYLSP   27 (174)
Q Consensus         2 ~~a~se~N~~~Rrpr~ReVsSRYls~   27 (174)
                      |||.++.+.      .++|+.||...
T Consensus        79 ViA~d~~~~------~kDVT~RY~~~   98 (145)
T PF03835_consen   79 VIAFDNDGY------AKDVTRRYASN   98 (145)
T ss_dssp             EEEE-CTTE------EEE-HHHH-T-
T ss_pred             EEEEeCCCC------EEEchHhhccc
Confidence            788876653      49999999974


No 6  
>cd08181 PPD-like 1,3-propanediol dehydrogenase-like (PPD). 1,3-propanediol dehydrogenase-like (PPD). This family is a member of the iron-containing alcohol dehydrogenase superfamily, and exhibits a dehydroquinate synthase-like fold.  Protein sequence similarity search and other biochemical evidences suggest that they are close to the iron-containing 1,3-propanediol dehydrogenase (EC 1.1.1.202). 1,3-propanediol dehydrogenase catalyzes the oxidation of propane-1,3-diol to 3-hydroxypropanal with the simultaneous reduction of NADP+ to NADPH. The protein structure of Thermotoga maritima TM0920 gene contains one NADP+ and one iron ion.
Probab=11.05  E-value=2.4e+02  Score=24.83  Aligned_cols=18  Identities=22%  Similarity=0.488  Sum_probs=16.0

Q ss_pred             hcCCCCCcCcHHHHHhhc
Q 030650          156 SMRTPPRTRTKEELKEAY  173 (174)
Q Consensus       156 sm~~~~~~~~~~~~~~~~  173 (174)
                      .|.+||+.-++|++++.|
T Consensus       339 ~~~~nP~~~t~~~i~~il  356 (357)
T cd08181         339 HKANTPGEVTEEDIRNIY  356 (357)
T ss_pred             CcCCCCCCCCHHHHHHHh
Confidence            467899999999999987


No 7  
>PRK09860 putative alcohol dehydrogenase; Provisional
Probab=10.82  E-value=2.4e+02  Score=25.25  Aligned_cols=23  Identities=26%  Similarity=0.228  Sum_probs=18.1

Q ss_pred             HHHhh-hcCCCCCcCcHHHHHhhc
Q 030650          151 RRRLN-SMRTPPRTRTKEELKEAY  173 (174)
Q Consensus       151 r~~~n-sm~~~~~~~~~~~~~~~~  173 (174)
                      .++++ .+.+||+.-++||+++.|
T Consensus       356 ~a~~~~~~~~np~~~t~~~i~~il  379 (383)
T PRK09860        356 NALKDACGFTNPIQATHEEIVAIY  379 (383)
T ss_pred             HHHhCcccCCCCCCCCHHHHHHHH
Confidence            45555 567899999999998866


No 8  
>cd08189 Fe-ADH5 Iron-containing alcohol dehydrogenases-like. Iron-containing alcohol dehydrogenase-like. Alcohol dehydrogenase catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions. The protein structure represents a dehydroquinate synthase-like fold and belongs to the alcohol dehydrogenase-like superfamily. They are distinct from other alcohol dehydrogenases which contains different protein domain. Proteins of this family have not been characterized. Their specific function is unknown.
Probab=10.48  E-value=2.6e+02  Score=24.72  Aligned_cols=23  Identities=17%  Similarity=0.265  Sum_probs=18.2

Q ss_pred             HHHhh--hcCCCCCcCcHHHHHhhc
Q 030650          151 RRRLN--SMRTPPRTRTKEELKEAY  173 (174)
Q Consensus       151 r~~~n--sm~~~~~~~~~~~~~~~~  173 (174)
                      .++++  .|.+||+.-++|++++.|
T Consensus       350 ~a~~~~~~~~~~p~~~~~e~i~~i~  374 (374)
T cd08189         350 RALKEANPLYPVPKLMDREECEQIL  374 (374)
T ss_pred             HHHhccccCCCCCCCCCHHHHHHhC
Confidence            34555  477899999999999876


No 9  
>cd08182 HEPD Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP). Hydroxyethylphosphoate dehydrogenase (HEPD) catalyzes the reduction of phosphonoacetaldehyde (PnAA) to hydroxyethylphosphoate (HEP) with either NADH or NADPH as a cofactor. NADH is the preferred cofactor. PnAA is a biosynthetic intermediate for several phosphonates such as the antibiotic fosfomycin, phosphinothricin tripeptide (PTT), and 2-aminoethylphosphonate (AEP). This enzyme is named PhpC in PTT biosynthesis pathway in Streptomyces hygroscopicus and S. viridochromogenes. Members of this family are only found in bacteria.
Probab=10.25  E-value=2.5e+02  Score=24.54  Aligned_cols=19  Identities=11%  Similarity=0.256  Sum_probs=16.7

Q ss_pred             hhcCCCCCcCcHHHHHhhc
Q 030650          155 NSMRTPPRTRTKEELKEAY  173 (174)
Q Consensus       155 nsm~~~~~~~~~~~~~~~~  173 (174)
                      +.|.+||+.-++||+++.|
T Consensus       348 ~~~~~~p~~~t~e~i~~i~  366 (367)
T cd08182         348 ERLDNNPVDLDEADLERLL  366 (367)
T ss_pred             ccccCCCCCCCHHHHHHHh
Confidence            4578899999999999987


No 10 
>cd08185 Fe-ADH1 Iron-containing alcohol dehydrogenases-like. Iron-containing alcohol dehydrogenases-like (ADH). Alcohol dehydrogenase catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions. The protein structure represents a dehydroquinate synthase fold and is a member of the iron-containing alcohol dehydrogenase-like family. They are distinct from other alcohol dehydrogenases which contain different protein domains. Proteins of this family have not been characterized. Their specific function is unknown. They are present in bacteria and archaea.
Probab=10.07  E-value=2.7e+02  Score=24.54  Aligned_cols=23  Identities=26%  Similarity=0.475  Sum_probs=18.3

Q ss_pred             HHHhh---hcCCCCCcCcHHHHHhhc
Q 030650          151 RRRLN---SMRTPPRTRTKEELKEAY  173 (174)
Q Consensus       151 r~~~n---sm~~~~~~~~~~~~~~~~  173 (174)
                      .++.+   .|.+||+.-++||+++.|
T Consensus       354 ~a~~~~~~~~~~nP~~~t~~~~~~i~  379 (380)
T cd08185         354 NARETMGGLFEADPAELTREDIEEIY  379 (380)
T ss_pred             HHHHhcccccCCCCCcCCHHHHHHHh
Confidence            45554   467899999999999987


Done!