Query         030651
Match_columns 174
No_of_seqs    158 out of 786
Neff          5.8 
Searched_HMMs 46136
Date          Fri Mar 29 02:32:17 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030651.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030651hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1591 Prolyl 4-hydroxylase a 100.0 1.4E-31 3.1E-36  230.5  10.2  167    8-174    10-188 (289)
  2 PLN00052 prolyl 4-hydroxylase; 100.0 1.1E-30 2.3E-35  227.1  13.7  105   70-174    40-144 (310)
  3 smart00702 P4Hc Prolyl 4-hydro  99.6 8.7E-16 1.9E-20  121.8   9.5   90   84-173     1-94  (178)
  4 PRK05467 Fe(II)-dependent oxyg  97.2  0.0015 3.2E-08   55.1   7.1   81   86-174     2-92  (226)
  5 PF13677 MotB_plug:  Membrane M  72.5      11 0.00025   24.9   4.8   24    1-24      1-24  (58)
  6 PHA02813 hypothetical protein;  67.5      14 0.00031   33.3   5.7   77   97-174    24-106 (354)
  7 PF13532 2OG-FeII_Oxy_2:  2OG-F  65.7      45 0.00097   26.0   7.8   21   86-106     2-22  (194)
  8 KOG3200 Uncharacterized conser  59.5      30 0.00065   28.8   5.8   87   79-174     7-100 (224)
  9 KOG3959 2-Oxoglutarate- and ir  50.2      10 0.00022   32.9   1.7   69   83-156    71-146 (306)
 10 PF03579 SHP:  Small hydrophobi  47.7      29 0.00063   23.6   3.2   29   12-40     13-41  (64)
 11 PHA02869 C4L/C10L-like gene fa  45.8      25 0.00053   32.5   3.5   64  108-174    44-115 (418)
 12 cd08788 CARD_NOD2_2_CARD15 Cas  38.0      14  0.0003   26.7   0.5   15   89-103    25-39  (81)
 13 PF07894 DUF1669:  Protein of u  36.8      41  0.0009   29.5   3.4   19   89-107    47-65  (284)
 14 PF15183 MRAP:  Melanocortin-2   36.5      50  0.0011   24.1   3.2   21   16-36     41-61  (90)
 15 PRK06489 hypothetical protein;  32.9 1.3E+02  0.0028   26.0   5.9   16   83-98     69-84  (360)
 16 PRK06666 fliM flagellar motor   30.6      78  0.0017   27.6   4.2   64   90-154     3-67  (337)
 17 PF05721 PhyH:  Phytanoyl-CoA d  30.4      59  0.0013   24.6   3.1   21   86-106     6-26  (211)
 18 PRK06925 flagellar motor prote  29.9      87  0.0019   26.0   4.2    6    1-6       1-6   (230)
 19 PF08069 Ribosomal_S13_N:  Ribo  28.3      40 0.00086   22.9   1.5   33   68-114    17-50  (60)
 20 PF05546 She9_MDM33:  She9 / Md  28.2      56  0.0012   27.5   2.7   25   12-36    148-173 (207)
 21 PF15330 SIT:  SHP2-interacting  27.6      48   0.001   24.8   2.0   18   24-41      4-21  (107)
 22 PF08173 YbgT_YccB:  Membrane b  24.1 1.6E+02  0.0034   17.1   3.3   21   17-37      4-24  (28)
 23 cd01793 Fubi Fubi ubiquitin-li  23.9      69  0.0015   21.4   2.2   20  140-159    18-37  (74)
 24 PF03754 DUF313:  Domain of unk  23.7      53  0.0011   24.9   1.6   12   90-101    50-61  (114)
 25 TIGR01397 fliM_switch flagella  23.3 1.4E+02  0.0031   25.7   4.5   61   91-153     1-62  (320)
 26 KOG3551 Syntrophins (type beta  22.9      54  0.0012   30.4   1.8   23   74-96    475-498 (506)
 27 PF15240 Pro-rich:  Proline-ric  22.6      32 0.00069   28.3   0.3   14   31-44      2-15  (179)
 28 PF12955 DUF3844:  Domain of un  22.2      79  0.0017   23.7   2.3   17   23-39     70-86  (103)
 29 PF01448 ELM2:  ELM2 domain;  I  22.2      97  0.0021   19.7   2.5   26   77-107    28-53  (55)
 30 PRK15401 alpha-ketoglutarate-d  22.0 4.7E+02    0.01   21.8   7.7   32  142-173    96-127 (213)
 31 PF13986 DUF4224:  Domain of un  21.7      69  0.0015   20.4   1.6   16   91-106     1-16  (47)
 32 COG3162 Predicted membrane pro  21.6   1E+02  0.0022   23.2   2.7   36   12-47     20-58  (102)
 33 PF12729 4HB_MCP_1:  Four helix  21.6      58  0.0013   23.9   1.5    7   36-42     24-30  (181)
 34 cd01812 BAG1_N Ubiquitin-like   20.8      84  0.0018   20.4   2.0   21  140-160    19-39  (71)
 35 TIGR02408 ectoine_ThpD ectoine  20.3 1.6E+02  0.0034   25.0   4.1   23   87-109    31-53  (277)
 36 PF13544 N_methyl_2:  Type IV p  20.1 1.3E+02  0.0027   17.4   2.4   16   11-26     10-25  (31)
 37 cd05567 PTS_IIB_mannitol PTS_I  20.1 1.2E+02  0.0026   20.9   2.8   21   83-103    65-85  (87)

No 1  
>KOG1591 consensus Prolyl 4-hydroxylase alpha subunit [Amino acid transport and metabolism]
Probab=99.97  E-value=1.4e-31  Score=230.51  Aligned_cols=167  Identities=34%  Similarity=0.456  Sum_probs=129.9

Q ss_pred             CCCCCCC--chHHHHHHHHHHHHHHHHHHHHhccccCCC---CCCCCCCCCCcchhhhhcccc------CCCCcCCCCce
Q 030651            8 RFPTRKS--SSSTLILTLLIMFTFAILILLAFGILSMPS---SSGDSRKANDLSSIVRKSMER------SEGDEGRAEQW   76 (174)
Q Consensus         8 ~~~~~~~--~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~------~~~~~~l~~~k   76 (174)
                      +...+++  +..+.++..+.....+...+..++.+..+.   ...+..-..++.........+      .++|+.++|.|
T Consensus        10 ~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~c~g~~~~~~~~~~~~~~~~~~~~~~~~~ap~k   89 (289)
T KOG1591|consen   10 KLGILKSALSLLTEVFSILPESIRALDNLKQLEQLLDKEQEFTVYEQGCRGELPPLTKLTLRRLSCRNRAGPFLRLAPVK   89 (289)
T ss_pred             eccchHhhhhhcchhhhcchhhHHHhhhhhhhhhhccccccccchhhhccCccCccchhHhhhhhcccccCcceeecchh
Confidence            4444443  234666777777777777777888887765   221111122222222211111      12899999999


Q ss_pred             eEEeccCccEEEEcCCCCHHHHHHHHHHhcCCcccceee-eCCCCCccccceeeeeeeeeCCCCcHHHHHHHHHHHHhcC
Q 030651           77 VEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVV-DSDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFTF  155 (174)
Q Consensus        77 vE~LS~dP~I~lyhdfLS~eEce~Li~lakp~L~rS~Vv-~~~tG~~~~s~~RTS~~awL~~~~~~vv~rI~~RIadlTG  155 (174)
                      +|++||+|++++|||||+++||++|+.+|+++|++++|. +..+|....+.+|+|+++|+..++++++++|++||+++||
T Consensus        90 ~E~lsw~P~~~~yhd~ls~~e~d~l~~lak~~l~~stv~~~~~~~~~~~~~~R~S~~t~l~~~~~~~~~~i~~ri~~~T~  169 (289)
T KOG1591|consen   90 LEELSWDPRVVLYHDFLSDEECDHLISLAKPKLERSTVVADKGTGHSTTSAVRTSSGTFLPDGASPVVSRIEQRIADLTG  169 (289)
T ss_pred             hhhcccCCceEeehhcCCHHHHHHHHHhhhhhhhceeeeccCCcccccceeeEecceeEecCCCCHHHHHHHHHHHhccC
Confidence            999999999999999999999999999999999999995 5555766777789999999999889999999999999999


Q ss_pred             CCCCCCcceeeeeccCCCC
Q 030651          156 FPLGMQFKFSLFFFYVLKK  174 (174)
Q Consensus       156 lp~e~~E~lQVlrY~i~~~  174 (174)
                      +|.+++|+|||+||++|+|
T Consensus       170 l~~e~~E~lqVlnYg~Gg~  188 (289)
T KOG1591|consen  170 LPVENGESLQVLNYGLGGH  188 (289)
T ss_pred             CCcccCccceEEEecCCcc
Confidence            9999999999999999986


No 2  
>PLN00052 prolyl 4-hydroxylase; Provisional
Probab=99.97  E-value=1.1e-30  Score=227.07  Aligned_cols=105  Identities=39%  Similarity=0.648  Sum_probs=99.7

Q ss_pred             cCCCCceeEEeccCccEEEEcCCCCHHHHHHHHHHhcCCcccceeeeCCCCCccccceeeeeeeeeCCCCcHHHHHHHHH
Q 030651           70 EGRAEQWVEVISWEPRAFVYHNFLSKEECEYLINLATPHMRKSTVVDSDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKR  149 (174)
Q Consensus        70 ~~l~~~kvE~LS~dP~I~lyhdfLS~eEce~Li~lakp~L~rS~Vv~~~tG~~~~s~~RTS~~awL~~~~~~vv~rI~~R  149 (174)
                      ..+.+.|+|+|||+|+|++||||||++||++||++|++++++|+|+++.+|+...++.|||+++|+.+.+++++++|++|
T Consensus        40 ~~~~~~kve~lS~~P~i~~~~nfLs~~Ecd~Li~la~~~l~~S~v~~~~~g~~~~s~~RTS~~~~l~~~~dpvv~~I~~R  119 (310)
T PLN00052         40 PPFNASRVKAVSWQPRIFVYKGFLSDAECDHLVKLAKKKIQRSMVADNKSGKSVMSEVRTSSGMFLDKRQDPVVSRIEER  119 (310)
T ss_pred             CCcCCceEEEecCCCCEEEECCcCCHHHHHHHHHhcccccccceeecCCCCccccCCCEEecceeecCCCCHHHHHHHHH
Confidence            35699999999999999999999999999999999999999999998877777788999999999999889999999999


Q ss_pred             HHHhcCCCCCCCcceeeeeccCCCC
Q 030651          150 IADFTFFPLGMQFKFSLFFFYVLKK  174 (174)
Q Consensus       150 IadlTGlp~e~~E~lQVlrY~i~~~  174 (174)
                      |+++||+|.+++|++||+||+.||+
T Consensus       120 ia~~t~lp~~~~E~lQVlrY~~Gq~  144 (310)
T PLN00052        120 IAAWTFLPEENAENIQILRYEHGQK  144 (310)
T ss_pred             HHHHhCCCcccCcceEEEecCCCCC
Confidence            9999999999999999999999985


No 3  
>smart00702 P4Hc Prolyl 4-hydroxylase alpha subunit homologues. Mammalian enzymes catalyse hydroxylation of collagen, for example. Prokaryotic enzymes might catalyse hydroxylation of antibiotic peptides. These are 2-oxoglutarate-dependent dioxygenases, requiring 2-oxoglutarate and dioxygen as cosubstrates and ferrous iron as a cofactor.
Probab=99.64  E-value=8.7e-16  Score=121.76  Aligned_cols=90  Identities=31%  Similarity=0.407  Sum_probs=80.8

Q ss_pred             ccEEEEcCCCCHHHHHHHHHHhcCCcccceeeeCCCCCccccceeeeeeeeeCCCC-cHHHHHHHHHHHHhcCCC---CC
Q 030651           84 PRAFVYHNFLSKEECEYLINLATPHMRKSTVVDSDTGKSKDSRVRTSSGTFLARGR-DKIIRDIEKRIADFTFFP---LG  159 (174)
Q Consensus        84 P~I~lyhdfLS~eEce~Li~lakp~L~rS~Vv~~~tG~~~~s~~RTS~~awL~~~~-~~vv~rI~~RIadlTGlp---~e  159 (174)
                      |.|++||||||++||++|++++++...++.+.++.++....+++|+|+.+|+...+ ++++++|.+||+++++++   ..
T Consensus         1 P~i~~~~~~ls~~ec~~li~~~~~~~~~~~~~~~~~~~~~~~~~R~~~~~~l~~~~~~~~~~~l~~~i~~~~~~~~~~~~   80 (178)
T smart00702        1 PGVVVFHDFLSPAECQKLLEEAEPLGWRGEVTRGDTNPNHDSKYRQSNGTWLELLKGDLVIERIRQRLADFLGLLRGLPL   80 (178)
T ss_pred             CcEEEECCCCCHHHHHHHHHHhhhhcccceeecCCCCccccCCCEeecceecCCCCCCHHHHHHHHHHHHHHCCCchhhc
Confidence            89999999999999999999999988888887664333256789999999999875 899999999999999998   78


Q ss_pred             CCcceeeeeccCCC
Q 030651          160 MQFKFSLFFFYVLK  173 (174)
Q Consensus       160 ~~E~lQVlrY~i~~  173 (174)
                      +.|.+|+++|+.|+
T Consensus        81 ~~~~~~~~~Y~~g~   94 (178)
T smart00702       81 SAEDAQVARYGPGG   94 (178)
T ss_pred             cCcceEEEEECCCC
Confidence            99999999999986


No 4  
>PRK05467 Fe(II)-dependent oxygenase superfamily protein; Provisional
Probab=97.15  E-value=0.0015  Score=55.11  Aligned_cols=81  Identities=14%  Similarity=0.103  Sum_probs=52.9

Q ss_pred             EEEEcCCCCHHHHHHHHHHhcC-CcccceeeeCCCCCccccceeeeeeeeeCCCCcHHHHHHHHHHHHhc---------C
Q 030651           86 AFVYHNFLSKEECEYLINLATP-HMRKSTVVDSDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFT---------F  155 (174)
Q Consensus        86 I~lyhdfLS~eEce~Li~lakp-~L~rS~Vv~~~tG~~~~s~~RTS~~awL~~~~~~vv~rI~~RIadlT---------G  155 (174)
                      |+.++||||++||+++++.... .+....+.    .......+|.....  .. +++..+.|.+||....         +
T Consensus         2 i~~I~~vLs~eec~~~~~~le~~~~~dg~~t----aG~~~~~vKnN~ql--~~-d~~~a~~l~~~i~~~L~~~~l~~sa~   74 (226)
T PRK05467          2 LLHIPDVLSPEEVAQIRELLDAAEWVDGRVT----AGAQAAQVKNNQQL--PE-DSPLARELGNLILDALTRNPLFFSAA   74 (226)
T ss_pred             eeeecccCCHHHHHHHHHHHHhcCCccCCcC----cCccchhccccccc--CC-CCHHHHHHHHHHHHHHhcCchhhhhc
Confidence            6789999999999999987753 34333332    12223345554443  33 4678888888887654         3


Q ss_pred             CCCCCCcceeeeeccCCCC
Q 030651          156 FPLGMQFKFSLFFFYVLKK  174 (174)
Q Consensus       156 lp~e~~E~lQVlrY~i~~~  174 (174)
                      +|. ..+++.+.+|..|+.
T Consensus        75 lp~-~i~~~~f~rY~~G~~   92 (226)
T PRK05467         75 LPR-KIHPPLFNRYEGGMS   92 (226)
T ss_pred             ccc-ccccceEEEECCCCc
Confidence            333 345788999999974


No 5  
>PF13677 MotB_plug:  Membrane MotB of proton-channel complex MotA/MotB 
Probab=72.49  E-value=11  Score=24.94  Aligned_cols=24  Identities=21%  Similarity=0.069  Sum_probs=11.8

Q ss_pred             CCCCCCCCCCCCCCchHHHHHHHH
Q 030651            1 MAKPRYSRFPTRKSSSSTLILTLL   24 (174)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~   24 (174)
                      |+|.|..+-.......|.+.++=|
T Consensus         1 Makkk~~~~~~~~~~~WlvtyaDl   24 (58)
T PF13677_consen    1 MAKKKKKEEEEEGSPRWLVTYADL   24 (58)
T ss_pred             CCCCCCCCCCCCCCccHHHHHHHH
Confidence            777776333333444454444433


No 6  
>PHA02813 hypothetical protein; Provisional
Probab=67.52  E-value=14  Score=33.27  Aligned_cols=77  Identities=17%  Similarity=0.184  Sum_probs=51.3

Q ss_pred             HHHHHHHHhcCCcccceeeeCCCCCc-cccceeeeeeeeeCCCCcHHHHHHHHHHH-HhcCCC----CCCCcceeeeecc
Q 030651           97 ECEYLINLATPHMRKSTVVDSDTGKS-KDSRVRTSSGTFLARGRDKIIRDIEKRIA-DFTFFP----LGMQFKFSLFFFY  170 (174)
Q Consensus        97 Ece~Li~lakp~L~rS~Vv~~~tG~~-~~s~~RTS~~awL~~~~~~vv~rI~~RIa-dlTGlp----~e~~E~lQVlrY~  170 (174)
                      ++-.+++.-.-.+..|.+.+..+|.. ...+.|+++.+-++.. +.+..+|.+-+- ++.|.+    +.-.|.+...+|.
T Consensus        24 ~l~~~i~~~d~~~~~s~i~~~~~~ge~l~~~iRnNkrviid~~-~~L~erIr~~Lp~~l~~~~lv~~V~vnerirfyrY~  102 (354)
T PHA02813         24 IIMDMIKYKDIIWEESKVFDHEKGGEVINTNERQCKQYIIRGL-DDIFKVIRKKLLLSFEFPQKISDIILDNTITLIKYE  102 (354)
T ss_pred             HHHHHHhccccCccccceeccccCceEEccccccceEEEEcCH-HHHHHHHHHhhHHHhcCCccceeEEEcceEEEEEEC
Confidence            33334443344578899998666643 3577999999988754 455555555555 344544    3558899999999


Q ss_pred             CCCC
Q 030651          171 VLKK  174 (174)
Q Consensus       171 i~~~  174 (174)
                      .||+
T Consensus       103 kGq~  106 (354)
T PHA02813        103 KGDF  106 (354)
T ss_pred             CCcc
Confidence            9984


No 7  
>PF13532 2OG-FeII_Oxy_2:  2OG-Fe(II) oxygenase superfamily; PDB: 2IUW_A 3BTZ_A 3RZL_A 3RZH_A 3S5A_A 3RZG_A 3RZJ_A 3BUC_A 3H8X_A 3H8R_A ....
Probab=65.73  E-value=45  Score=26.04  Aligned_cols=21  Identities=38%  Similarity=0.487  Sum_probs=17.2

Q ss_pred             EEEEcCCCCHHHHHHHHHHhc
Q 030651           86 AFVYHNFLSKEECEYLINLAT  106 (174)
Q Consensus        86 I~lyhdfLS~eEce~Li~lak  106 (174)
                      +++++||||++|...|++...
T Consensus         2 ~~~~~~fls~~e~~~l~~~l~   22 (194)
T PF13532_consen    2 LYYIPNFLSEEEAAELLNELR   22 (194)
T ss_dssp             EEEETTSS-HHHHHHHHHHHH
T ss_pred             EEEECCCCCHHHHHHHHHHHH
Confidence            578999999999999887664


No 8  
>KOG3200 consensus Uncharacterized conserved protein [Function unknown]
Probab=59.48  E-value=30  Score=28.78  Aligned_cols=87  Identities=11%  Similarity=0.179  Sum_probs=51.3

Q ss_pred             EeccCccEEEEcCCCCHHHHHHHHHHh----cCCccc---ceeeeCCCCCccccceeeeeeeeeCCCCcHHHHHHHHHHH
Q 030651           79 VISWEPRAFVYHNFLSKEECEYLINLA----TPHMRK---STVVDSDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIA  151 (174)
Q Consensus        79 ~LS~dP~I~lyhdfLS~eEce~Li~la----kp~L~r---S~Vv~~~tG~~~~s~~RTS~~awL~~~~~~vv~rI~~RIa  151 (174)
                      ++-..|.+++++|||++||-..+..-.    +|+++-   -...+.  |+ .     .....-+++.--+..+++...|.
T Consensus         7 ~V~~~pt~~YIPnfIt~EEe~~~lshIe~ap~pkW~~L~NRRLqNy--GG-v-----vh~~glipeelP~wLq~~v~kin   78 (224)
T KOG3200|consen    7 IVKSAPTMIYIPNFITEEEENLYLSHIENAPQPKWRVLANRRLQNY--GG-V-----VHKTGLIPEELPPWLQYYVDKIN   78 (224)
T ss_pred             EecccceEEEcCCccChHHHHHHHHHHhcCCCchhHHHHhhhhhhc--CC-c-----cccCCcCccccCHHHHHHHHHhh
Confidence            345678999999999999987765433    333211   111111  11 1     11223344444566778877777


Q ss_pred             HhcCCCCCCCcceeeeeccCCCC
Q 030651          152 DFTFFPLGMQFKFSLFFFYVLKK  174 (174)
Q Consensus       152 dlTGlp~e~~E~lQVlrY~i~~~  174 (174)
                      ++-=++ ..+...-|-.|..||.
T Consensus        79 nlglF~-s~~NHVLVNeY~pgqG  100 (224)
T KOG3200|consen   79 NLGLFK-SPANHVLVNEYLPGQG  100 (224)
T ss_pred             cccccC-CCcceeEeecccCCCC
Confidence            544344 3677777888888873


No 9  
>KOG3959 consensus 2-Oxoglutarate- and iron-dependent dioxygenase-related proteins [General function prediction only]
Probab=50.18  E-value=10  Score=32.85  Aligned_cols=69  Identities=17%  Similarity=0.256  Sum_probs=41.9

Q ss_pred             CccEEEEcCCCCHHHHHHHHHHhcC-Ccccc------eeeeCCCCCccccceeeeeeeeeCCCCcHHHHHHHHHHHHhcC
Q 030651           83 EPRAFVYHNFLSKEECEYLINLATP-HMRKS------TVVDSDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFTF  155 (174)
Q Consensus        83 dP~I~lyhdfLS~eEce~Li~lakp-~L~rS------~Vv~~~tG~~~~s~~RTS~~awL~~~~~~vv~rI~~RIadlTG  155 (174)
                      =|-|.++|||||.+|=+.|+++-.. -+.-|      .-+++++ ++...+.||-..+=+++    ...-+-+|+.+..+
T Consensus        71 ~pG~~lie~Fls~~Eea~l~~~~D~~pW~~SQSGRRKQdyGPKv-NFkk~Klkt~~F~G~P~----~~~~v~rrm~~yp~  145 (306)
T KOG3959|consen   71 IPGLTLIENFLSESEEAKLLNMIDTVPWAQSQSGRRKQDYGPKV-NFKKKKLKTDTFVGMPE----YADMVLRRMSEYPV  145 (306)
T ss_pred             cCCeeehhhhhccchHhHHHHHhccCchhhhcccccccccCCcc-chhhhhhccCcccCCch----HHHHHHHHhhccch
Confidence            3889999999999999999988752 11111      2223322 23344566655554444    45566667776654


Q ss_pred             C
Q 030651          156 F  156 (174)
Q Consensus       156 l  156 (174)
                      +
T Consensus       146 l  146 (306)
T KOG3959|consen  146 L  146 (306)
T ss_pred             h
Confidence            4


No 10 
>PF03579 SHP:  Small hydrophobic protein;  InterPro: IPR005327 The small hydrophobic integral membrane protein, SH (previously designated 1A) is found to have a variety of glycosylated forms [, ]. This protein is a component of the mature respiratory syncytial virion [] where it may form complexes and appears to play a structural role.; GO: 0016020 membrane, 0016021 integral to membrane, 0048222 glycoprotein network
Probab=47.69  E-value=29  Score=23.62  Aligned_cols=29  Identities=28%  Similarity=0.257  Sum_probs=22.6

Q ss_pred             CCCchHHHHHHHHHHHHHHHHHHHHhccc
Q 030651           12 RKSSSSTLILTLLIMFTFAILILLAFGIL   40 (174)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~   40 (174)
                      +-|.-+||++.++.+.+|+|++-+..+||
T Consensus        13 kFW~YFtLi~M~lti~~~~Iv~si~~AIL   41 (64)
T PF03579_consen   13 KFWTYFTLIFMMLTIGFFFIVTSIMAAIL   41 (64)
T ss_pred             ccchHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34677799999998888888877766664


No 11 
>PHA02869 C4L/C10L-like gene family protein; Provisional
Probab=45.79  E-value=25  Score=32.46  Aligned_cols=64  Identities=9%  Similarity=0.112  Sum_probs=45.4

Q ss_pred             CcccceeeeCCCCC-ccccceeeeeeeeeCCCCcHHHHHHHHHHHH-----hcCC--CCCCCcceeeeeccCCCC
Q 030651          108 HMRKSTVVDSDTGK-SKDSRVRTSSGTFLARGRDKIIRDIEKRIAD-----FTFF--PLGMQFKFSLFFFYVLKK  174 (174)
Q Consensus       108 ~L~rS~Vv~~~tG~-~~~s~~RTS~~awL~~~~~~vv~rI~~RIad-----lTGl--p~e~~E~lQVlrY~i~~~  174 (174)
                      ....|.+.+..+|. ......|+|++.-+..   .....|.+||+.     +-|+  .+.-.|.+...+|..||.
T Consensus        44 ~~~~s~i~~~~~g~e~~~~~~~ksKqii~e~---~La~~L~erlr~lLp~~lk~~v~~V~lnerirfyrY~kGq~  115 (418)
T PHA02869         44 ICEDSKIFFPEKRTELLSIKDRKSKQIVFEN---SLNDDLLKKLHALIYDELSTVVDSVTVENTVTLIMYEKGDY  115 (418)
T ss_pred             ccccceeeccccCceeEeeccccceeEEech---HHHHHHHHHHHHhhhHHhhCccceEEEcceEEEEEECCCCc
Confidence            45889999877773 3456679999998864   345555555553     4454  446689999999999984


No 12 
>cd08788 CARD_NOD2_2_CARD15 Caspase activation and recruitment domain of NOD2, repeat 2. Caspase activation and recruitment domain (CARD) similar to that found in human NOD2 (CARD15), repeat 2. NOD2 is a member of the Nod-like receptor (NLR) family, which plays a central role in the innate immune response. NLRs typically contain an N-terminal effector domain, a central nucleotide-binding domain and a C-terminal ligand-binding region of several leucine-rich repeats (LRRs). In NOD2, as well as NOD1, the N-terminal effector domain is a CARD. NOD2 contains two N-terminal CARD repeats. Mutations in NOD2 have been associated with Crohns disease and Blau syndrome. Nod2-CARDs have been shown to interact with the CARD domain of the downstream effector RICK (RIP2, CARDIAK), a serine/threonine kinase. In general, CARDs are death domains (DDs) found associated with caspases. They are known to be important in the signaling pathways for apoptosis, inflammation, and host-defense mechanisms. DDs are pr
Probab=38.04  E-value=14  Score=26.66  Aligned_cols=15  Identities=20%  Similarity=0.430  Sum_probs=12.9

Q ss_pred             EcCCCCHHHHHHHHH
Q 030651           89 YHNFLSKEECEYLIN  103 (174)
Q Consensus        89 yhdfLS~eEce~Li~  103 (174)
                      =++|+|++||+.+..
T Consensus        25 ~~G~is~~Ecd~Ir~   39 (81)
T cd08788          25 TRGFFSSYDCDEIRL   39 (81)
T ss_pred             HcCCccHhhcchhhc
Confidence            478999999999875


No 13 
>PF07894 DUF1669:  Protein of unknown function (DUF1669);  InterPro: IPR012461 This family is composed of sequences derived from hypothetical eukaryotic proteins of unknown function. Some members of this family are annotated as being potential phospholipases but no literature was found to support this. 
Probab=36.80  E-value=41  Score=29.48  Aligned_cols=19  Identities=37%  Similarity=0.599  Sum_probs=17.0

Q ss_pred             EcCCCCHHHHHHHHHHhcC
Q 030651           89 YHNFLSKEECEYLINLATP  107 (174)
Q Consensus        89 yhdfLS~eEce~Li~lakp  107 (174)
                      ..||||++|+++|.+.++.
T Consensus        47 ~~~FLS~~Ei~~I~~~~~~   65 (284)
T PF07894_consen   47 ERDFLSSEEIQYILENAED   65 (284)
T ss_pred             CCCCCCHHHHHHHHHhccC
Confidence            5799999999999999864


No 14 
>PF15183 MRAP:  Melanocortin-2 receptor accessory protein family
Probab=36.53  E-value=50  Score=24.09  Aligned_cols=21  Identities=24%  Similarity=0.494  Sum_probs=14.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHH
Q 030651           16 SSTLILTLLIMFTFAILILLA   36 (174)
Q Consensus        16 ~~~~~~~~~~~~~~~~~~~l~   36 (174)
                      .+-+.|++|+++.|+||+++.
T Consensus        41 ~FWv~LA~FV~~lF~iL~~ms   61 (90)
T PF15183_consen   41 AFWVSLAAFVVFLFLILLYMS   61 (90)
T ss_pred             hHHHHHHHHHHHHHHHHHHHh
Confidence            345667778787777777764


No 15 
>PRK06489 hypothetical protein; Provisional
Probab=32.92  E-value=1.3e+02  Score=26.01  Aligned_cols=16  Identities=13%  Similarity=0.158  Sum_probs=13.5

Q ss_pred             CccEEEEcCCCCHHHH
Q 030651           83 EPRAFVYHNFLSKEEC   98 (174)
Q Consensus        83 dP~I~lyhdfLS~eEc   98 (174)
                      .|.|+++|++..+.++
T Consensus        69 gpplvllHG~~~~~~~   84 (360)
T PRK06489         69 DNAVLVLHGTGGSGKS   84 (360)
T ss_pred             CCeEEEeCCCCCchhh
Confidence            5889999999987665


No 16 
>PRK06666 fliM flagellar motor switch protein FliM; Validated
Probab=30.63  E-value=78  Score=27.55  Aligned_cols=64  Identities=17%  Similarity=0.218  Sum_probs=33.5

Q ss_pred             cCCCCHHHHHHHHHHhcC-CcccceeeeCCCCCccccceeeeeeeeeCCCCcHHHHHHHHHHHHhc
Q 030651           90 HNFLSKEECEYLINLATP-HMRKSTVVDSDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADFT  154 (174)
Q Consensus        90 hdfLS~eEce~Li~lakp-~L~rS~Vv~~~tG~~~~s~~RTS~~awL~~~~~~vv~rI~~RIadlT  154 (174)
                      .++||.+|++.|.+-... ....+..... ........|.-....-+..+.-+....|++|.++..
T Consensus         3 ~~~LSQ~EIdaLL~~~~~g~~~~~~~~~~-~~~~~~~~ydf~~~~~~~~~~l~~L~~i~e~far~~   67 (337)
T PRK06666          3 DDILSQEEIDALLSGVSDGEVDDEELKEE-GDEKKVRPYDFKRQERFSRERLRSLEIINERFARLL   67 (337)
T ss_pred             ccccCHHHHHHHHhccccCCcCccccccc-cccCCcccCCCCCccccccccchHHHHHHHHHHHHH
Confidence            479999999999864332 1111110000 011112233333434455556678888888877543


No 17 
>PF05721 PhyH:  Phytanoyl-CoA dioxygenase (PhyH);  InterPro: IPR008775 This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins as well as a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalysing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterised by the accumulation of phytanic acid in plasma and tissues [].; PDB: 3GJA_A 3EMR_A 3OBZ_A 2OPW_A 3NNL_B 3NNF_A 3NNM_B 3NNJ_A 2FCV_B 2FCU_A ....
Probab=30.40  E-value=59  Score=24.60  Aligned_cols=21  Identities=38%  Similarity=0.290  Sum_probs=16.6

Q ss_pred             EEEEcCCCCHHHHHHHHHHhc
Q 030651           86 AFVYHNFLSKEECEYLINLAT  106 (174)
Q Consensus        86 I~lyhdfLS~eEce~Li~lak  106 (174)
                      .+++.||++++||+.|.+...
T Consensus         6 yvvi~~~l~~~~~~~l~~~~~   26 (211)
T PF05721_consen    6 YVVIRNVLSPEEVERLREELD   26 (211)
T ss_dssp             EEEETTSS-HHHHHHHHHHHH
T ss_pred             EEEECCcCCHHHHHHHHHHHH
Confidence            368999999999999976664


No 18 
>PRK06925 flagellar motor protein MotS; Reviewed
Probab=29.91  E-value=87  Score=25.99  Aligned_cols=6  Identities=17%  Similarity=0.390  Sum_probs=4.2

Q ss_pred             CCCCCC
Q 030651            1 MAKPRY    6 (174)
Q Consensus         1 ~~~~~~    6 (174)
                      |+|.|+
T Consensus         1 M~~k~~    6 (230)
T PRK06925          1 MERRKR    6 (230)
T ss_pred             CCCCcc
Confidence            777765


No 19 
>PF08069 Ribosomal_S13_N:  Ribosomal S13/S15 N-terminal domain;  InterPro: IPR012606 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This domain is found at the N terminus of ribosomal S13 and S15 proteins. This domain is also identified as NUC021 [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome; PDB: 3U5C_N 3O30_G 3IZB_O 3O2Z_G 3U5G_N 2XZN_O 2XZM_O 3IZ6_O.
Probab=28.30  E-value=40  Score=22.90  Aligned_cols=33  Identities=24%  Similarity=0.407  Sum_probs=19.7

Q ss_pred             CCcCCCCceeEEeccCccEEEEcCCCCHHHHHH-HHHHhcCCccccee
Q 030651           68 GDEGRAEQWVEVISWEPRAFVYHNFLSKEECEY-LINLATPHMRKSTV  114 (174)
Q Consensus        68 ~~~~l~~~kvE~LS~dP~I~lyhdfLS~eEce~-Li~lakp~L~rS~V  114 (174)
                      |+-+..|-|++              ++.+|++. ++++|+..+.+|.+
T Consensus        17 P~~~~~P~W~~--------------~~~~eVe~~I~klakkG~tpSqI   50 (60)
T PF08069_consen   17 PYRRSPPSWLK--------------YSPEEVEELIVKLAKKGLTPSQI   50 (60)
T ss_dssp             -S-SS--TT----------------S-HHHHHHHHHHHCCTTHCHHHH
T ss_pred             CCCCCCCCCcC--------------CCHHHHHHHHHHHHHcCCCHHHh
Confidence            45555666654              57888876 56999999988764


No 20 
>PF05546 She9_MDM33:  She9 / Mdm33 family;  InterPro: IPR008839 Members of this family are mitochondrial inner membrane proteins with a role in inner mitochondrial membrane organisation and biogenesis []. The yeast Mdm33 protein assembles into an oligomeric complex in the inner membrane where it performs homotypic protein-protein interactions. It has been suggested that Mdm33 plays a distinct role, possibly involved in fission of the mitochondrial inner membrane [].
Probab=28.16  E-value=56  Score=27.45  Aligned_cols=25  Identities=28%  Similarity=0.273  Sum_probs=16.8

Q ss_pred             CCCchH-HHHHHHHHHHHHHHHHHHH
Q 030651           12 RKSSSS-TLILTLLIMFTFAILILLA   36 (174)
Q Consensus        12 ~~~~~~-~~~~~~~~~~~~~~~~~l~   36 (174)
                      |..|+| |++|..+-++.|+++.++.
T Consensus       148 Rr~STwgT~~lmgvNvllFl~~~~~~  173 (207)
T PF05546_consen  148 RRASTWGTWGLMGVNVLLFLVAQLLV  173 (207)
T ss_pred             HhHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            445666 7777777777777776653


No 21 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=27.57  E-value=48  Score=24.81  Aligned_cols=18  Identities=28%  Similarity=0.469  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHhcccc
Q 030651           24 LIMFTFAILILLAFGILS   41 (174)
Q Consensus        24 ~~~~~~~~~~~l~~~~~~   41 (174)
                      +.++++++||++++-++.
T Consensus         4 l~il~llLll~l~asl~~   21 (107)
T PF15330_consen    4 LGILALLLLLSLAASLLA   21 (107)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            344455555555555543


No 22 
>PF08173 YbgT_YccB:  Membrane bound YbgT-like protein;  InterPro: IPR012994 This family contains a set of membrane proteins, typically 33 amino acids long. The family has no known function, but the protein is found in the operon CydAB in Escherichia coli. Members have a consensus motif (MWYFXW), which is rich in aromatic residues. The protein forms a single membrane-spanning helix. This family seems to be restricted to proteobacteria [].
Probab=24.09  E-value=1.6e+02  Score=17.05  Aligned_cols=21  Identities=29%  Similarity=0.388  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHh
Q 030651           17 STLILTLLIMFTFAILILLAF   37 (174)
Q Consensus        17 ~~~~~~~~~~~~~~~~~~l~~   37 (174)
                      ++-++.+++.++|.++..+.+
T Consensus         4 faWilG~~lA~~~~i~~a~wl   24 (28)
T PF08173_consen    4 FAWILGVLLACAFGILNAMWL   24 (28)
T ss_pred             HHHHHHHHHHHHHHHHHHHHh
Confidence            467888888888887766543


No 23 
>cd01793 Fubi Fubi ubiquitin-like protein. Fubi is a ubiquitin-like protein encoded by the fau gene which has an  N-terminal ubiquitin-like domain (also referred to as FUBI) fused to the ribosomal protein S30.  Fubi is thought to be a tumor suppressor protein and the FUBI domain may act as a substitute or an inhibitor of ubiquitin or one of ubiquitin's close relatives UCRP, FAT10, and Nedd8.
Probab=23.92  E-value=69  Score=21.44  Aligned_cols=20  Identities=15%  Similarity=0.303  Sum_probs=17.4

Q ss_pred             cHHHHHHHHHHHHhcCCCCC
Q 030651          140 DKIIRDIEKRIADFTFFPLG  159 (174)
Q Consensus       140 ~~vv~rI~~RIadlTGlp~e  159 (174)
                      +..|..+.++|++..|+|.+
T Consensus        18 ~~tV~~lK~~i~~~~gip~~   37 (74)
T cd01793          18 QETVSDIKAHVAGLEGIDVE   37 (74)
T ss_pred             cCcHHHHHHHHHhhhCCCHH
Confidence            45889999999999999874


No 24 
>PF03754 DUF313:  Domain of unknown function (DUF313) ;  InterPro: IPR005508 This is a family of proteins from Arabidopsis thaliana (Mouse-ear cress) with uncharacterised function.
Probab=23.66  E-value=53  Score=24.89  Aligned_cols=12  Identities=33%  Similarity=0.667  Sum_probs=11.3

Q ss_pred             cCCCCHHHHHHH
Q 030651           90 HNFLSKEECEYL  101 (174)
Q Consensus        90 hdfLS~eEce~L  101 (174)
                      .|||+++|++.|
T Consensus        50 ~dFLt~eE~~~i   61 (114)
T PF03754_consen   50 NDFLTEEEKRII   61 (114)
T ss_pred             cccCCHHHHHHH
Confidence            689999999999


No 25 
>TIGR01397 fliM_switch flagellar motor switch protein FliM. Members of this family are the flagellar motor switch protein FliM. The family excludes FliM homologs that lack an N-terminal region critical to interaction with phosphorylated CheY. One set lacking this N-terminal region is found in Rhizobium meliloti, in which the direction of flagellar rotation is not reversible (i.e. the FliM homolog does not act to reverse the motor direction), and in related species. Another is found in Buchnera, an obligate intracellular endosymbiont with genes for many of the components of the flagellar apparatus, but not, apparently, for flagellin iself.
Probab=23.26  E-value=1.4e+02  Score=25.67  Aligned_cols=61  Identities=15%  Similarity=0.157  Sum_probs=30.1

Q ss_pred             CCCCHHHHHHHHHHhcC-CcccceeeeCCCCCccccceeeeeeeeeCCCCcHHHHHHHHHHHHh
Q 030651           91 NFLSKEECEYLINLATP-HMRKSTVVDSDTGKSKDSRVRTSSGTFLARGRDKIIRDIEKRIADF  153 (174)
Q Consensus        91 dfLS~eEce~Li~lakp-~L~rS~Vv~~~tG~~~~s~~RTS~~awL~~~~~~vv~rI~~RIadl  153 (174)
                      |+||.+|+|.|.+.... .-..+...... + .....|.-....-+..+.-+..+.|.+|.+..
T Consensus         1 ~~Lsq~EIdaLl~~~~~g~~~~~~~~~~~-~-~~v~~ydf~~~~~~s~~~l~~Le~i~e~far~   62 (320)
T TIGR01397         1 DILSQDEIDALLGGLSEGDDSDEPSAVED-E-KKVKPYDFKRPDRVSKEQLRTLEIINERFARL   62 (320)
T ss_pred             CCCCHHHHHHHHhcccCCCcccccccccc-c-CCceecCCCCccccchhhhhHHHHHHHHHHHH
Confidence            68999999999854422 11111000000 1 11222333333334455556777777777643


No 26 
>KOG3551 consensus Syntrophins (type beta) [Extracellular structures]
Probab=22.91  E-value=54  Score=30.44  Aligned_cols=23  Identities=35%  Similarity=0.606  Sum_probs=17.7

Q ss_pred             CceeEEecc-CccEEEEcCCCCHH
Q 030651           74 EQWVEVISW-EPRAFVYHNFLSKE   96 (174)
Q Consensus        74 ~~kvE~LS~-dP~I~lyhdfLS~e   96 (174)
                      ++.+...|. +|-||++|+|||.+
T Consensus       475 EiqLDLhscpKpiVFIlHsfLSAK  498 (506)
T KOG3551|consen  475 EIQLDLHSCPKPIVFILHSFLSAK  498 (506)
T ss_pred             cEEeeeccCCCcEEEEehhhhhhh
Confidence            455555555 99999999999864


No 27 
>PF15240 Pro-rich:  Proline-rich
Probab=22.61  E-value=32  Score=28.27  Aligned_cols=14  Identities=36%  Similarity=0.783  Sum_probs=7.1

Q ss_pred             HHHHHHhccccCCC
Q 030651           31 ILILLAFGILSMPS   44 (174)
Q Consensus        31 ~~~~l~~~~~~~~~   44 (174)
                      |||||.+++|+|.+
T Consensus         2 LlVLLSvALLALSS   15 (179)
T PF15240_consen    2 LLVLLSVALLALSS   15 (179)
T ss_pred             hhHHHHHHHHHhhh
Confidence            34555555555543


No 28 
>PF12955 DUF3844:  Domain of unknown function (DUF3844);  InterPro: IPR024382 This presumed domain is found in fungal species. It contains 8 largely conserved cysteine residues. This domain is found in proteins thought to be located in the endoplasmic reticulum.
Probab=22.20  E-value=79  Score=23.68  Aligned_cols=17  Identities=41%  Similarity=0.585  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHHHHhcc
Q 030651           23 LLIMFTFAILILLAFGI   39 (174)
Q Consensus        23 ~~~~~~~~~~~~l~~~~   39 (174)
                      +|+-++++++++++++|
T Consensus        70 L~~~~ti~lv~~~~~~I   86 (103)
T PF12955_consen   70 LFAGFTIALVVLVAGAI   86 (103)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            33344444444444443


No 29 
>PF01448 ELM2:  ELM2 domain;  InterPro: IPR000949 The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function. It is found in the MTA1 protein that is part of the NuRD complex []. The domain is usually found to the N terminus of a myb-like DNA binding domain and a GATA binding domain. ELM2, in some instances, is also found associated with the ARID DNA binding domain IPR001606 from INTERPRO. This suggests that ELM2 may also be involved in DNA binding, or perhaps is a protein-protein interaction domain.
Probab=22.18  E-value=97  Score=19.72  Aligned_cols=26  Identities=31%  Similarity=0.524  Sum_probs=22.3

Q ss_pred             eEEeccCccEEEEcCCCCHHHHHHHHHHhcC
Q 030651           77 VEVISWEPRAFVYHNFLSKEECEYLINLATP  107 (174)
Q Consensus        77 vE~LS~dP~I~lyhdfLS~eEce~Li~lakp  107 (174)
                      -+.+=|+|     ++-+++++.+..+.+|+.
T Consensus        28 ~e~lvW~P-----~~~~~d~~l~~yl~~A~s   53 (55)
T PF01448_consen   28 EEELVWSP-----NNPLSDRKLEEYLKVAKS   53 (55)
T ss_pred             cceEeECC-----CCCCCHHHHHHHHHHHHh
Confidence            67788999     589999999999998874


No 30 
>PRK15401 alpha-ketoglutarate-dependent dioxygenase AlkB; Provisional
Probab=21.99  E-value=4.7e+02  Score=21.82  Aligned_cols=32  Identities=13%  Similarity=-0.113  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHHhcCCCCCCCcceeeeeccCCC
Q 030651          142 IIRDIEKRIADFTFFPLGMQFKFSLFFFYVLK  173 (174)
Q Consensus       142 vv~rI~~RIadlTGlp~e~~E~lQVlrY~i~~  173 (174)
                      ....|.++++..+|++.-..+..=|-.|..|+
T Consensus        96 ~l~~L~~~~~~~~~~~~~~p~a~LvN~Y~~G~  127 (213)
T PRK15401         96 SFLALAQRAAAAAGFPGFQPDACLINRYAPGA  127 (213)
T ss_pred             HHHHHHHHHHHHcCCCCCCCCEEEEEeccCcC
Confidence            68899999999988865556666677777665


No 31 
>PF13986 DUF4224:  Domain of unknown function (DUF4224)
Probab=21.65  E-value=69  Score=20.36  Aligned_cols=16  Identities=31%  Similarity=0.455  Sum_probs=12.2

Q ss_pred             CCCCHHHHHHHHHHhc
Q 030651           91 NFLSKEECEYLINLAT  106 (174)
Q Consensus        91 dfLS~eEce~Li~lak  106 (174)
                      .|||++|+..|-..-+
T Consensus         1 ~fLT~~El~elTG~k~   16 (47)
T PF13986_consen    1 EFLTDEELQELTGYKR   16 (47)
T ss_pred             CCCCHHHHHHHHCCCC
Confidence            5899999988865443


No 32 
>COG3162 Predicted membrane protein [Function unknown]
Probab=21.61  E-value=1e+02  Score=23.15  Aligned_cols=36  Identities=31%  Similarity=0.391  Sum_probs=20.0

Q ss_pred             CCCchHHHHHHHHHHHHHHHHHHHH---hccccCCCCCC
Q 030651           12 RKSSSSTLILTLLIMFTFAILILLA---FGILSMPSSSG   47 (174)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~l~---~~~~~~~~~~~   47 (174)
                      ||..+++..++++++..-+.++||+   =+.++.|....
T Consensus        20 ~kr~~Fa~~ltl~flv~Y~~filLiaf~~~~l~tp~~~~   58 (102)
T COG3162          20 RKRRRFAVPLTLIFLVVYFGFILLIAFAPGWLATPLFGA   58 (102)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHhcCcccCC
Confidence            3455566666665555444444443   36777776544


No 33 
>PF12729 4HB_MCP_1:  Four helix bundle sensory module for signal transduction;  InterPro: IPR024478 This entry represents a four-helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction, which is known as four-helix bundles methyl-accepting chemotaxis protein (4HB_MCP) domain. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterised in E coli chemoreceptors [].
Probab=21.57  E-value=58  Score=23.92  Aligned_cols=7  Identities=29%  Similarity=0.653  Sum_probs=2.6

Q ss_pred             HhccccC
Q 030651           36 AFGILSM   42 (174)
Q Consensus        36 ~~~~~~~   42 (174)
                      ++|+.++
T Consensus        24 ~~~~~~l   30 (181)
T PF12729_consen   24 IVGLYSL   30 (181)
T ss_pred             HHHHHHH
Confidence            3344333


No 34 
>cd01812 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N  N-terminal ubiquitin-like (Ubl) domain of the BAG1 protein.  This domain occurs together with the BAG domain and is closely related to the Ubl domain of a family of deubiquitinases that includes Rpn11, UBP6 (USP14), USP7 (HAUSP).
Probab=20.78  E-value=84  Score=20.36  Aligned_cols=21  Identities=19%  Similarity=0.086  Sum_probs=17.6

Q ss_pred             cHHHHHHHHHHHHhcCCCCCC
Q 030651          140 DKIIRDIEKRIADFTFFPLGM  160 (174)
Q Consensus       140 ~~vv~rI~~RIadlTGlp~e~  160 (174)
                      +..+..+.+.|+..+|+|.+.
T Consensus        19 ~~tv~~lK~~i~~~~gi~~~~   39 (71)
T cd01812          19 QATFGDLKKMLAPVTGVEPRD   39 (71)
T ss_pred             CCcHHHHHHHHHHhhCCChHH
Confidence            457889999999999998743


No 35 
>TIGR02408 ectoine_ThpD ectoine hydroxylase. Both ectoine and hydroxyectoine are compatible solvents that serve as protectants against osmotic and thermal stresses. A number of genomes synthesize ectoine. This enzyme allows conversion of ectoine to hydroxyectoine, which may be more effective for some purposes, and is found in a subset of ectoine-producing organisms.
Probab=20.31  E-value=1.6e+02  Score=24.97  Aligned_cols=23  Identities=17%  Similarity=0.287  Sum_probs=18.6

Q ss_pred             EEEcCCCCHHHHHHHHHHhcCCc
Q 030651           87 FVYHNFLSKEECEYLINLATPHM  109 (174)
Q Consensus        87 ~lyhdfLS~eEce~Li~lakp~L  109 (174)
                      +++.+||+++||+.|.+.....+
T Consensus        31 vvl~~vls~eev~~lr~~i~~~~   53 (277)
T TIGR02408        31 LLLENLFSDDEVAALLAEVERMT   53 (277)
T ss_pred             EECcccCCHHHHHHHHHHHHHHH
Confidence            46899999999999988765433


No 36 
>PF13544 N_methyl_2:  Type IV pilin N-term methylation site GFxxxE; PDB: 3SOK_A 2HIL_L 1AY2_A 2PIL_A 2HI2_A 1OQW_A.
Probab=20.10  E-value=1.3e+02  Score=17.39  Aligned_cols=16  Identities=38%  Similarity=0.428  Sum_probs=3.9

Q ss_pred             CCCCchHHHHHHHHHH
Q 030651           11 TRKSSSSTLILTLLIM   26 (174)
Q Consensus        11 ~~~~~~~~~~~~~~~~   26 (174)
                      .++..-+||+=.+..+
T Consensus        10 ~~~~~GFTLiEllVa~   25 (31)
T PF13544_consen   10 RRRQRGFTLIELLVAM   25 (31)
T ss_dssp             --------HHHHHHHH
T ss_pred             ccccCCccHHHHHHHH
Confidence            3344556666544433


No 37 
>cd05567 PTS_IIB_mannitol PTS_IIB_mannitol: subunit IIB of enzyme II (EII) of the mannitol-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In this system, EII is a mannitol-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain.  The IIA, IIB, and IIC domains are expressed from the mtlA gene as a single protein, also known as the mannitol PTS permease, the mtl transporter, or MtlA. MtlA is only functional as a dimer with the dimer contacts occuring between the IIC domains. MtlA takes up exogenous mannitol releasing the phosphate ester into the cytoplasm in preparation  for oxidation to fructose-6-phosphate by the NAD-dependent mannitol-P dehydrogenase (MtlD). The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include mannitol, chitobiose/lichenan, ascorbate, lactose, galactitol, fructose, and a s
Probab=20.09  E-value=1.2e+02  Score=20.94  Aligned_cols=21  Identities=29%  Similarity=0.482  Sum_probs=18.3

Q ss_pred             CccEEEEcCCCCHHHHHHHHH
Q 030651           83 EPRAFVYHNFLSKEECEYLIN  103 (174)
Q Consensus        83 dP~I~lyhdfLS~eEce~Li~  103 (174)
                      +..|+.+.+|++++|.+.+++
T Consensus        65 ~~~vi~v~~~l~~~ei~~i~~   85 (87)
T cd05567          65 QAQHLSVDNFLNTPEYDELIE   85 (87)
T ss_pred             CCeEEEEeccCChHHHHHHHH
Confidence            467889999999999998875


Done!