Query         030664
Match_columns 173
No_of_seqs    110 out of 381
Neff          5.9 
Searched_HMMs 46136
Date          Fri Mar 29 02:44:11 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030664.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030664hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3160 Gamma-interferon induc 100.0 1.8E-44 3.9E-49  299.0   9.8  133   36-172    35-167 (220)
  2 PF03227 GILT:  Gamma interfero 100.0 1.5E-41 3.2E-46  253.3  10.1  107   42-151     1-107 (108)
  3 cd03023 DsbA_Com1_like DsbA fa  96.9  0.0037 7.9E-08   46.7   6.7  115   38-171     3-117 (154)
  4 cd03019 DsbA_DsbA DsbA family,  95.6   0.024 5.1E-07   43.7   4.8  112   39-170    14-130 (178)
  5 PF13462 Thioredoxin_4:  Thiore  93.9    0.15 3.3E-06   38.5   5.4   46   35-83      7-54  (162)
  6 PF13743 Thioredoxin_5:  Thiore  92.9    0.12 2.7E-06   41.2   3.7  122   46-170     2-134 (176)
  7 PRK11657 dsbG disulfide isomer  90.5    0.63 1.4E-05   39.3   5.5   46   36-86    113-158 (251)
  8 cd02972 DsbA_family DsbA famil  88.6    0.77 1.7E-05   30.8   3.9   41   44-87      1-41  (98)
  9 PF14595 Thioredoxin_9:  Thiore  86.4     1.4   3E-05   33.7   4.5   44   37-84     38-81  (129)
 10 cd03025 DsbA_FrnE_like DsbA fa  86.4     1.4   3E-05   34.3   4.7  127   42-171     1-157 (193)
 11 TIGR00411 redox_disulf_1 small  83.9     2.6 5.6E-05   28.0   4.5   26   42-68      1-26  (82)
 12 cd02973 TRX_GRX_like Thioredox  83.5     2.6 5.7E-05   27.3   4.3   17   42-58      1-17  (67)
 13 KOG2501 Thioredoxin, nucleored  82.8    0.51 1.1E-05   37.8   0.7   76   25-103    18-95  (157)
 14 cd03020 DsbA_DsbC_DsbG DsbA fa  81.6     3.3 7.3E-05   33.0   5.1   44   37-87     74-117 (197)
 15 cd03026 AhpF_NTD_C TRX-GRX-lik  71.6     9.5 0.00021   27.0   4.6   41   38-82     10-50  (89)
 16 cd02066 GRX_family Glutaredoxi  71.2     3.6 7.8E-05   26.0   2.1   16   43-58      1-16  (72)
 17 PF13905 Thioredoxin_8:  Thiore  70.5      14 0.00031   25.2   5.2   42   40-84      1-44  (95)
 18 PRK10954 periplasmic protein d  69.3      15 0.00033   29.6   5.9  113   39-170    36-154 (207)
 19 TIGR02190 GlrX-dom Glutaredoxi  68.5     4.3 9.3E-05   27.7   2.1   21   38-58      4-24  (79)
 20 TIGR02200 GlrX_actino Glutared  67.0     4.2   9E-05   26.6   1.8   16   43-58      1-16  (77)
 21 PRK10877 protein disulfide iso  66.2      15 0.00033   30.5   5.4   60   37-102   104-167 (232)
 22 PF01323 DSBA:  DSBA-like thior  66.1      14 0.00029   28.5   4.8   38   43-84      1-38  (193)
 23 cd03419 GRX_GRXh_1_2_like Glut  65.4     5.7 0.00012   26.4   2.2   16   43-58      1-16  (82)
 24 PF00462 Glutaredoxin:  Glutare  62.7     6.7 0.00014   25.0   2.1   16   44-59      1-16  (60)
 25 PF13098 Thioredoxin_2:  Thiore  60.6      20 0.00044   25.1   4.5   27   38-65      3-29  (112)
 26 TIGR02180 GRX_euk Glutaredoxin  60.4     6.4 0.00014   26.2   1.8   16   44-59      1-16  (84)
 27 PF07172 GRP:  Glycine rich pro  59.2     6.8 0.00015   28.7   1.8   28    1-29      1-28  (95)
 28 cd03418 GRX_GRXb_1_3_like Glut  58.8     6.6 0.00014   25.8   1.6   16   43-58      1-16  (75)
 29 cd03024 DsbA_FrnE DsbA family,  58.3      20 0.00043   28.0   4.5  125   44-171     1-163 (201)
 30 cd02949 TRX_NTR TRX domain, no  58.2      33 0.00073   23.7   5.3   34   38-74     11-44  (97)
 31 cd03027 GRX_DEP Glutaredoxin (  57.5      11 0.00024   25.0   2.5   17   43-59      2-18  (73)
 32 COG1651 DsbG Protein-disulfide  56.6      36 0.00077   27.7   5.9   23   37-59     81-103 (244)
 33 KOG3425 Uncharacterized conser  56.4      17 0.00036   28.2   3.6   36   49-87     42-77  (128)
 34 PF13728 TraF:  F plasmid trans  55.6      11 0.00023   31.2   2.6   40   38-84    118-157 (215)
 35 TIGR02196 GlrX_YruB Glutaredox  54.9     7.5 0.00016   24.7   1.3   16   43-58      1-16  (74)
 36 PRK13728 conjugal transfer pro  54.6      11 0.00024   30.6   2.5   34   44-84     73-106 (181)
 37 PRK13703 conjugal pilus assemb  54.3     9.4  0.0002   32.6   2.1   38   40-84    143-180 (248)
 38 PRK11200 grxA glutaredoxin 1;   53.8      10 0.00022   25.9   2.0   22   43-65      2-23  (85)
 39 PHA03050 glutaredoxin; Provisi  53.2       9  0.0002   28.2   1.7   16   43-58     14-29  (108)
 40 cd02976 NrdH NrdH-redoxin (Nrd  53.1      11 0.00024   23.9   1.9   16   43-58      1-16  (73)
 41 cd03009 TryX_like_TryX_NRX Try  52.6      30 0.00066   25.1   4.5   41   27-69      6-46  (131)
 42 cd02995 PDI_a_PDI_a'_C PDIa fa  52.5      35 0.00076   23.2   4.6   38   40-80     18-55  (104)
 43 TIGR02189 GlrX-like_plant Glut  52.1     9.6 0.00021   27.4   1.6   17   43-59      9-25  (99)
 44 TIGR02181 GRX_bact Glutaredoxi  51.8       9 0.00019   25.6   1.4   15   44-58      1-15  (79)
 45 PRK15317 alkyl hydroperoxide r  51.1      17 0.00037   33.4   3.5   25   35-59    111-135 (517)
 46 cd02964 TryX_like_family Trypa  50.4      35 0.00076   25.1   4.5   46   34-82     11-57  (132)
 47 PF00085 Thioredoxin:  Thioredo  49.4      33 0.00072   23.1   4.0   32   40-74     17-48  (103)
 48 cd01659 TRX_superfamily Thiore  47.8      42  0.0009   19.1   3.8   35   44-82      1-35  (69)
 49 COG0695 GrxC Glutaredoxin and   47.7      12 0.00027   25.9   1.6   16   43-58      2-17  (80)
 50 cd03029 GRX_hybridPRX5 Glutare  47.4      15 0.00033   24.1   1.9   16   43-58      2-17  (72)
 51 PF11287 DUF3088:  Protein of u  47.1      10 0.00022   28.8   1.1   33   51-87     23-55  (112)
 52 TIGR02739 TraF type-F conjugat  47.0      15 0.00032   31.5   2.2   38   40-84    150-187 (256)
 53 TIGR02183 GRXA Glutaredoxin, G  46.4      13 0.00029   25.7   1.6   15   44-58      2-16  (86)
 54 TIGR01126 pdi_dom protein disu  45.3      46   0.001   22.4   4.2   21   39-59     12-32  (102)
 55 PRK10638 glutaredoxin 3; Provi  44.6      21 0.00045   24.3   2.3   17   43-59      3-19  (83)
 56 cd03012 TlpA_like_DipZ_like Tl  43.8      68  0.0015   23.2   5.2   43   37-83     20-62  (126)
 57 TIGR03140 AhpF alkyl hydropero  43.5      29 0.00062   32.0   3.7   46   13-59     87-136 (515)
 58 cd02961 PDI_a_family Protein D  43.3      74  0.0016   20.9   5.0   26   42-68     17-42  (101)
 59 PF13192 Thioredoxin_3:  Thiore  42.2      88  0.0019   20.9   5.2   35   42-82      1-35  (76)
 60 cd02965 HyaE HyaE family; HyaE  40.2      57  0.0012   24.4   4.2   36   38-76     25-62  (111)
 61 TIGR01295 PedC_BrcD bacterioci  39.2      23 0.00051   26.3   2.0   19   40-58     23-41  (122)
 62 PRK09381 trxA thioredoxin; Pro  38.6      97  0.0021   21.6   5.2   30   39-69     20-49  (109)
 63 PRK10329 glutaredoxin-like pro  37.8      26 0.00057   24.2   2.0   20   43-63      2-21  (81)
 64 TIGR01068 thioredoxin thioredo  37.3      82  0.0018   20.9   4.5   27   40-67     14-40  (101)
 65 cd03001 PDI_a_P5 PDIa family,   37.0   1E+02  0.0022   20.9   5.0   20   40-59     18-37  (103)
 66 cd02950 TxlA TRX-like protein   36.9      87  0.0019   23.7   4.9   22   38-59     18-39  (142)
 67 cd03002 PDI_a_MPD1_like PDI fa  36.2      84  0.0018   21.7   4.5   21   39-59     17-37  (109)
 68 TIGR02194 GlrX_NrdH Glutaredox  36.0      21 0.00047   23.5   1.3   15   44-58      1-15  (72)
 69 PTZ00051 thioredoxin; Provisio  35.7 1.1E+02  0.0024   20.6   5.0   29   39-68     17-45  (98)
 70 COG2761 FrnE Predicted dithiol  34.1      78  0.0017   26.8   4.6  119   38-166     2-167 (225)
 71 cd03040 GST_N_mPGES2 GST_N fam  33.9      30 0.00065   22.7   1.7   17   43-59      1-17  (77)
 72 cd02998 PDI_a_ERp38 PDIa famil  33.2      91   0.002   21.0   4.2   21   39-59     17-37  (105)
 73 cd03004 PDI_a_ERdj5_C PDIa fam  31.0 1.6E+02  0.0035   20.2   5.2   21   39-59     18-38  (104)
 74 KOG1752 Glutaredoxin and relat  31.0      36 0.00079   25.2   1.9   39   43-85     15-53  (104)
 75 TIGR02738 TrbB type-F conjugat  31.0      65  0.0014   25.1   3.4   20   40-59     50-69  (153)
 76 cd02969 PRX_like1 Peroxiredoxi  30.9 1.1E+02  0.0024   23.3   4.7   41   39-83     24-64  (171)
 77 cd02993 PDI_a_APS_reductase PD  30.8 1.3E+02  0.0028   21.2   4.8   22   38-59     19-40  (109)
 78 PF15299 ALS2CR8:  Amyotrophic   30.5      15 0.00033   30.5  -0.2   25   74-102    20-44  (225)
 79 cd02956 ybbN ybbN protein fami  30.4 1.3E+02  0.0029   20.2   4.6   22   38-59     10-31  (96)
 80 COG4545 Glutaredoxin-related p  29.7      33 0.00072   24.6   1.4   19   45-64      5-23  (85)
 81 cd02962 TMX2 TMX2 family; comp  29.2 1.2E+02  0.0027   23.6   4.7   19   40-58     47-65  (152)
 82 PF06110 DUF953:  Eukaryotic pr  28.9 1.1E+02  0.0024   23.1   4.2   20   49-69     35-54  (119)
 83 cd02953 DsbDgamma DsbD gamma f  28.6      73  0.0016   22.1   3.1   21   39-59     10-30  (104)
 84 cd02975 PfPDO_like_N Pyrococcu  27.9 1.3E+02  0.0027   21.8   4.3   19   40-58     21-40  (113)
 85 PRK10996 thioredoxin 2; Provis  27.9 1.3E+02  0.0029   22.5   4.6   30   39-69     51-80  (139)
 86 PRK03147 thiol-disulfide oxido  27.9 2.4E+02  0.0051   21.1   6.1   30   39-69     60-89  (173)
 87 cd02997 PDI_a_PDIR PDIa family  27.3   1E+02  0.0022   20.8   3.6   20   40-59     17-36  (104)
 88 PTZ00443 Thioredoxin domain-co  27.3 2.9E+02  0.0064   22.9   6.9   20   40-59     52-71  (224)
 89 cd03003 PDI_a_ERdj5_N PDIa fam  27.3 2.1E+02  0.0045   19.6   5.3   19   40-58     18-36  (101)
 90 cd03010 TlpA_like_DsbE TlpA-li  26.9      54  0.0012   23.6   2.2   27   39-66     24-50  (127)
 91 cd03022 DsbA_HCCA_Iso DsbA fam  26.9 1.2E+02  0.0025   23.2   4.2   32  140-171   124-155 (192)
 92 cd02967 mauD Methylamine utili  26.8 1.9E+02  0.0041   20.0   5.1   20   40-59     21-40  (114)
 93 TIGR01617 arsC_related transcr  26.8      46   0.001   24.4   1.8   16   44-59      1-16  (117)
 94 cd02996 PDI_a_ERp44 PDIa famil  26.6 2.2E+02  0.0049   19.7   5.5   20   40-59     18-37  (108)
 95 TIGR02187 GlrX_arch Glutaredox  26.5 1.3E+02  0.0027   24.3   4.5   22   37-58    130-151 (215)
 96 cd03008 TryX_like_RdCVF Trypar  26.3 1.2E+02  0.0025   23.6   4.1   31   37-68     22-52  (146)
 97 PF12273 RCR:  Chitin synthesis  25.1      44 0.00096   25.1   1.5   17    7-23      3-19  (130)
 98 cd03037 GST_N_GRX2 GST_N famil  25.0      37 0.00081   21.9   0.9   14   45-58      2-15  (71)
 99 COG4856 Uncharacterized protei  24.9      97  0.0021   28.4   3.8   43    9-51     13-61  (403)
100 TIGR02740 TraF-like TraF-like   24.3      75  0.0016   27.1   2.9   21   39-59    165-185 (271)
101 PF08534 Redoxin:  Redoxin;  In  23.5 1.4E+02  0.0031   21.7   4.1   30   37-67     25-55  (146)
102 cd03028 GRX_PICOT_like Glutare  23.5      55  0.0012   22.8   1.6   16   43-58      9-29  (90)
103 cd02999 PDI_a_ERp44_like PDIa   23.5   2E+02  0.0044   20.1   4.7   23   37-59     15-37  (100)
104 PF00578 AhpC-TSA:  AhpC/TSA fa  23.2 1.2E+02  0.0027   21.1   3.5   30   39-69     24-54  (124)
105 cd02951 SoxW SoxW family; SoxW  23.1      89  0.0019   22.5   2.8   20   41-60     15-34  (125)
106 cd02968 SCO SCO (an acronym fo  22.8   2E+02  0.0043   20.7   4.6   33   39-74     21-54  (142)
107 cd03006 PDI_a_EFP1_N PDIa fami  22.3 2.1E+02  0.0046   20.9   4.7   21   38-58     27-47  (113)
108 cd02948 TRX_NDPK TRX domain, T  22.2 2.8E+02   0.006   19.2   5.4   29   39-68     16-44  (102)
109 TIGR00412 redox_disulf_2 small  22.2 2.3E+02  0.0051   18.8   4.6   24   43-68      2-25  (76)
110 cd02992 PDI_a_QSOX PDIa family  21.8 3.1E+02  0.0067   19.6   5.6   21   39-59     18-38  (114)
111 PRK13675 GTP cyclohydrolase; P  21.7 1.4E+02  0.0031   26.2   4.2   29   39-67    144-172 (308)
112 cd02947 TRX_family TRX family;  21.6      81  0.0018   20.1   2.1   19   41-59     11-29  (93)
113 PHA00407 phage lambda Rz1-like  21.3 1.3E+02  0.0029   21.5   3.1   33   11-49     37-71  (84)
114 TIGR03143 AhpF_homolog putativ  21.2 1.8E+02  0.0039   27.1   5.0   23   37-59    473-495 (555)
115 cd03032 ArsC_Spx Arsenate Redu  21.2      84  0.0018   22.9   2.3   32   44-84      2-33  (115)
116 smart00594 UAS UAS domain.      21.2      50  0.0011   24.2   1.1   43   39-85     26-68  (122)
117 PF04134 DUF393:  Protein of un  20.8 1.1E+02  0.0025   21.7   2.9   32   46-84      1-32  (114)
118 TIGR03399 RNA_3prim_cycl RNA 3  20.7 4.2E+02  0.0091   23.4   6.9   62    7-86     93-156 (326)
119 cd02966 TlpA_like_family TlpA-  20.4 2.7E+02  0.0058   18.3   5.1   30   39-69     18-47  (116)

No 1  
>KOG3160 consensus Gamma-interferon inducible lysosomal thiol reductase [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=1.8e-44  Score=299.05  Aligned_cols=133  Identities=43%  Similarity=0.808  Sum_probs=122.0

Q ss_pred             CCCCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeeeeeecCCCceeecCChhhhhcChhhhhhhc
Q 030664           36 SDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAKIRANNSTFDCQHGPSECLLNTVEACAID  115 (173)
Q Consensus        36 ~~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A~~~~~~~~f~CQHG~~EC~gN~~qaCai~  115 (173)
                      ..+.+||+|+||||||||||++||++||+|+|++ .+.+++||++||||||+..+++++++||||+.||.+|++|+|+|+
T Consensus        35 ~~~~~~v~ItlyyEaLCPdc~~Fi~~qL~p~~~~-~~~~~idl~lvPfGna~~~~~~~~~~CqHG~~EC~lN~LqaCvI~  113 (220)
T KOG3160|consen   35 GSQAPKVNITLYYEALCPDCSKFIRNQLYPFFDN-LLPSILDLTLVPFGNAQCRNDGGTFTCQHGEEECKLNKLQACVID  113 (220)
T ss_pred             cccCCeeEEEEEEEecCccHHHHHHHHHHHHHhh-cccceeEEEEEccCCceeecCceEEEecCCHHHHhhhHHHHHHHH
Confidence            3556699999999999999999999999999997 589999999999999999877699999999999999999999999


Q ss_pred             cccccccccceeecccccccccccchHHhHHhhcCCCchhhhcccCCchhhHHHHhh
Q 030664          116 SWPELNKHFPFIYCIESLVYEHKYSQWETCFDKLELDPKPIVDCYTSGYGTQVSLAL  172 (173)
Q Consensus       116 ~~~~~~~~l~fI~Cm~~~~~~~~~~~~~~Ca~~~gld~~~I~~C~~~~~G~~Ll~~~  172 (173)
                      +++++.++++||.||++.   .+.+.+.+|+++.++++..|++|++|++|++|++++
T Consensus       114 ~l~~~~~~l~~i~C~~~~---~~~~~~~~C~~~~~~~~~~i~~Ca~s~~g~~L~~~~  167 (220)
T KOG3160|consen  114 TLPDQSDQLPFIRCIQGK---QKLSEAEDCLEKYGLNEKKIRECANSRLGAKLLLKY  167 (220)
T ss_pred             hhhchHhhhceehhhhcc---cchhHHHHHHhhcCCCHHHHHHHhcCchHHHHHHHH
Confidence            999999999999999983   234457789999999999999999999999999864


No 2  
>PF03227 GILT:  Gamma interferon inducible lysosomal thiol reductase (GILT);  InterPro: IPR004911  This family includes the two characterised human gamma-interferon-inducible lysosomal thiol reductase (GILT) sequences [, ]. It also contains several other eukaryotic putative proteins with similarity to GILT []. The aligned region contains three conserved cysteine residues. In addition, the two GILT sequences possess a C-X(2)-C motif that is shared by some of the other sequences in the family. This motif is thought to be associated with disulphide bond reduction. 
Probab=100.00  E-value=1.5e-41  Score=253.35  Aligned_cols=107  Identities=40%  Similarity=0.764  Sum_probs=95.2

Q ss_pred             eEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeeeeeecCCCceeecCChhhhhcChhhhhhhccccccc
Q 030664           42 VKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAKIRANNSTFDCQHGPSECLLNTVEACAIDSWPELN  121 (173)
Q Consensus        42 V~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A~~~~~~~~f~CQHG~~EC~gN~~qaCai~~~~~~~  121 (173)
                      |+|+|||||+||||++||++||.|+|..+++.++|||+|||||||+.+.++.+|+|||||.||+||++|+|+++++++..
T Consensus         1 V~v~vyyESlCPd~~~fi~~~L~p~~~~~~~~~~~~l~lvP~G~a~~~~~~~~~~CqHG~~EC~gN~~q~C~l~~~~~~~   80 (108)
T PF03227_consen    1 VNVEVYYESLCPDCRRFITNQLFPVWTYEKLSDIMNLTLVPFGNAKVSSSGNEFTCQHGPDECYGNKLQACALKHLPDTN   80 (108)
T ss_pred             CEEEEEEEecCHhHHHHHHHHHHHHHHHhhccceEEEEEEEEeccEEecCCceeecCCcHHHHHcCHHHHhHHHhcCChh
Confidence            79999999999999999999999988555799999999999999998876457999999999999999999999999888


Q ss_pred             cccceeecccccccccccchHHhHHhhcCC
Q 030664          122 KHFPFIYCIESLVYEHKYSQWETCFDKLEL  151 (173)
Q Consensus       122 ~~l~fI~Cm~~~~~~~~~~~~~~Ca~~~gl  151 (173)
                      .+|+||+||++....  ...+ .||+++++
T Consensus        81 ~~~~~i~Cm~~~~~~--~~~~-~Ca~~~~~  107 (108)
T PF03227_consen   81 AALPFIACMESSQDF--PKAI-KCAKKYGI  107 (108)
T ss_pred             hhcCEEEEEcCCCCC--chhh-hhHHhcCC
Confidence            899999999988542  2233 39999875


No 3  
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti. It contains a CXXC motif, assumed to be imbedded in a DsbA-like structure. Its homology to DsbA suggests that the protein is a protein disulfide oxidoreductase. The role of such a protein in pathogenesis is unknown.
Probab=96.91  E-value=0.0037  Score=46.67  Aligned_cols=115  Identities=13%  Similarity=0.069  Sum_probs=64.8

Q ss_pred             CCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeeeeeecCCCceeecCChhhhhcChhhhhhhccc
Q 030664           38 VNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAKIRANNSTFDCQHGPSECLLNTVEACAIDSW  117 (173)
Q Consensus        38 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A~~~~~~~~f~CQHG~~EC~gN~~qaCai~~~  117 (173)
                      .+.++.|.+|+--.||.|++|- ..|.+.+..  ..+ +++.++||--..  .. .       .   ..-+.-.|+... 
T Consensus         3 ~~a~~~i~~f~D~~Cp~C~~~~-~~l~~~~~~--~~~-~~~~~~~~p~~~--~~-~-------~---~~~~~~~~~~~~-   64 (154)
T cd03023           3 PNGDVTIVEFFDYNCGYCKKLA-PELEKLLKE--DPD-VRVVFKEFPILG--ES-S-------V---LAARVALAVWKN-   64 (154)
T ss_pred             CCCCEEEEEEECCCChhHHHhh-HHHHHHHHH--CCC-ceEEEEeCCccC--cc-h-------H---HHHHHHHHHHHh-
Confidence            4578999999999999999994 566665544  444 666766662111  00 0       0   001111122211 


Q ss_pred             cccccccceeecccccccccccchHHhHHhhcCCCchhhhcccCCchhhHHHHh
Q 030664          118 PELNKHFPFIYCIESLVYEHKYSQWETCFDKLELDPKPIVDCYTSGYGTQVSLA  171 (173)
Q Consensus       118 ~~~~~~l~fI~Cm~~~~~~~~~~~~~~Ca~~~gld~~~I~~C~~~~~G~~Ll~~  171 (173)
                       ++...++|..=+.........+.....+++.|++.+.+.+|.++++.++.+.+
T Consensus        65 -~~~~~~~~~~~lf~~~~~~~~~~l~~~a~~~gl~~~~~~~~~~~~~~~~~~~~  117 (154)
T cd03023          65 -GPGKYLEFHNALMATRGRLNEESLLRIAKKAGLDEAKLKKDMDDPEIEATIDK  117 (154)
T ss_pred             -ChhHHHHHHHHHHhcCCCCCHHHHHHHHHHcCCCHHHHHHHhhChHHHHHHHH
Confidence             22233343222211111112233567789999999999999998776665543


No 4  
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold. It is involved in the oxidative protein folding pathway in prokaryotes, and is the strongest thiol oxidant known, due to the unusual stability of the thiolate anion form of the first cysteine in the CXXC motif. The highly unstable oxidized form of DsbA directly donates disulfide bonds to reduced proteins secreted into the bacterial periplasm. This rapid and unidirectional process helps to catalyze the folding of newly-synthesized polypeptides. To regain catalytic activity, reduced DsbA is then reoxidized by the membrane protein DsbB, which generates its disulfides from oxidized quinones, which in turn are reoxidized by the electron transport chain.
Probab=95.58  E-value=0.024  Score=43.73  Aligned_cols=112  Identities=14%  Similarity=0.003  Sum_probs=67.7

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeeeeeecCCCceeecCChhhhhcChhhhhhhcccc
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAKIRANNSTFDCQHGPSECLLNTVEACAIDSWP  118 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A~~~~~~~~f~CQHG~~EC~gN~~qaCai~~~~  118 (173)
                      +.+|.|..|+-=.||.|++| ...+.+.+.+  ..+.+.++++|.........             ...+....+.. . 
T Consensus        14 ~~~~~i~~f~D~~Cp~C~~~-~~~~~~~~~~--~~~~v~~~~~~~~~~~~~~~-------------~aa~a~~aa~~-~-   75 (178)
T cd03019          14 SGKPEVIEFFSYGCPHCYNF-EPILEAWVKK--LPKDVKFEKVPVVFGGGEGE-------------PLARAFYAAEA-L-   75 (178)
T ss_pred             CCCcEEEEEECCCCcchhhh-hHHHHHHHHh--CCCCceEEEcCCccccccch-------------HHHHHHHHHHH-c-
Confidence            68999999999999999999 4668888876  68889999999764321100             00111111111 0 


Q ss_pred             ccccccceeecccc-----cccccccchHHhHHhhcCCCchhhhcccCCchhhHHHH
Q 030664          119 ELNKHFPFIYCIES-----LVYEHKYSQWETCFDKLELDPKPIVDCYTSGYGTQVSL  170 (173)
Q Consensus       119 ~~~~~l~fI~Cm~~-----~~~~~~~~~~~~Ca~~~gld~~~I~~C~~~~~G~~Ll~  170 (173)
                        ...+.|..=+..     .......+.+.+.|++.|++.+.+.+|.++++-++.+.
T Consensus        76 --~~~~~~~~~lf~~~~~~~~~~~~~~~l~~~a~~~Gl~~~~~~~~~~s~~~~~~i~  130 (178)
T cd03019          76 --GLEDKLHAALFEAIHEKRKRLLDPDDIRKIFLSQGVDKKKFDAAYNSFSVKALVA  130 (178)
T ss_pred             --CcHhhhhHHHHHHHHHhCCCCCCHHHHHHHHHHhCCCHHHHHHHHhCHHHHHHHH
Confidence              111122111111     01111134577889999999999999998876544443


No 5  
>PF13462 Thioredoxin_4:  Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A ....
Probab=93.88  E-value=0.15  Score=38.47  Aligned_cols=46  Identities=17%  Similarity=0.353  Sum_probs=35.8

Q ss_pred             CCCCCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccC--CceeeEEEEEe
Q 030664           35 PSDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDL--LSIVDLHLSPW   83 (173)
Q Consensus        35 ~~~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l--~d~vdl~lvP~   83 (173)
                      .+..+.++.|++|..=.||.|++|.. .+.+++.+  +  .+.+.+.++|+
T Consensus         7 ~G~~~a~~~v~~f~d~~Cp~C~~~~~-~~~~~~~~--~i~~~~v~~~~~~~   54 (162)
T PF13462_consen    7 IGNPDAPITVTEFFDFQCPHCAKFHE-ELEKLLKK--YIDPGKVKFVFRPV   54 (162)
T ss_dssp             ES-TTTSEEEEEEE-TTSHHHHHHHH-HHHHHHHH--HTTTTTEEEEEEES
T ss_pred             ecCCCCCeEEEEEECCCCHhHHHHHH-HHhhhhhh--ccCCCceEEEEEEc
Confidence            44567799999999999999999964 45577775  6  67889999887


No 6  
>PF13743 Thioredoxin_5:  Thioredoxin; PDB: 3KZQ_C.
Probab=92.95  E-value=0.12  Score=41.19  Aligned_cols=122  Identities=16%  Similarity=0.151  Sum_probs=63.9

Q ss_pred             EEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeeeeeecCC-CceeecCChh--hhhcChhhhhhh-cc--ccc
Q 030664           46 LYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAKIRANN-STFDCQHGPS--ECLLNTVEACAI-DS--WPE  119 (173)
Q Consensus        46 vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A~~~~~~-~~f~CQHG~~--EC~gN~~qaCai-~~--~~~  119 (173)
                      +|+--+||.|-.+ ...|..+...  +.+.+++++||.|++...... ....+.+..-  +=..+...+|.- +.  ...
T Consensus         2 ~F~dPlc~~C~~~-E~~l~kl~~~--~~~~i~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~a~la~kAA~~qg   78 (176)
T PF13743_consen    2 LFVDPLCSWCWGF-EPELRKLKEE--YGNKIEFRFIPGGLMPDINDFMPRMPINGDFWRNEPRSSSYPACLAYKAAQLQG   78 (176)
T ss_dssp             EEE-TT-HHHHHH-HHHHHHHHHH--S-TTEEEEEEE--SS-S--SB--H----TTHHHS--BS--HHHHHHHHHHHTTT
T ss_pred             eeeCCCChHHHHh-HHHHHHHHHH--cCCcEEEEEEEccchHHHHHHHHhcCCCHHHhcCCCCCCchHHHHHHHHHHHhC
Confidence            4667799999988 4556666664  999999999999998743221 1112222221  112344555521 11  224


Q ss_pred             cccccceeeccccccc-----ccccchHHhHHhhcCCCchhhhcccCCchhhHHHH
Q 030664          120 LNKHFPFIYCIESLVY-----EHKYSQWETCFDKLELDPKPIVDCYTSGYGTQVSL  170 (173)
Q Consensus       120 ~~~~l~fI~Cm~~~~~-----~~~~~~~~~Ca~~~gld~~~I~~C~~~~~G~~Ll~  170 (173)
                      .++...|+.-|.+...     ....+....+|++.|+|.+...+=..|+..++.+.
T Consensus        79 ~k~~~~fL~~lQ~a~~~~~~~~s~~~~l~~iA~~~gLD~~~F~~d~~S~~~~~~~~  134 (176)
T PF13743_consen   79 KKKARRFLRALQEALFLEGKNYSDEELLLEIAEELGLDVEMFKEDLHSDEAKQAFQ  134 (176)
T ss_dssp             -H--HHHHHHHHHHHHTS---TTSHHHHHHHHHHTT--HHHHHHHHTSHHHHHHHH
T ss_pred             hhhHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHhCCCHHHHHHHHhChHHHHHHH
Confidence            4666788877765542     12235578999999999988776666666666554


No 7  
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional
Probab=90.54  E-value=0.63  Score=39.30  Aligned_cols=46  Identities=15%  Similarity=0.241  Sum_probs=35.5

Q ss_pred             CCCCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeee
Q 030664           36 SDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNA   86 (173)
Q Consensus        36 ~~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A   86 (173)
                      ...+.|..|.||.--.||+|++|- ..+.|..+.    ..+.++++|++--
T Consensus       113 g~~~ak~~I~vFtDp~CpyC~kl~-~~l~~~~~~----g~V~v~~ip~~~l  158 (251)
T PRK11657        113 GKADAPRIVYVFADPNCPYCKQFW-QQARPWVDS----GKVQLRHILVGII  158 (251)
T ss_pred             cCCCCCeEEEEEECCCChhHHHHH-HHHHHHhhc----CceEEEEEecccc
Confidence            345778899999999999999995 457775543    3488999998643


No 8  
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins. Members of this family contain a redox active CXXC motif (except GSTK and HCCA isomerase) imbedded in a TRX fold, and an alpha helical insert of about 75 residues (shorter in DsbC and DsbG) relative to TRX. DsbA is involved in the oxidative protein folding pathway in prokaryotes, catalyzing disulfide bond formation of proteins secreted into the bacterial periplasm. DsbC and DsbG function as protein disulfide isomerases and chaperones to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins.
Probab=88.59  E-value=0.77  Score=30.78  Aligned_cols=41  Identities=22%  Similarity=0.314  Sum_probs=32.4

Q ss_pred             EEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeeee
Q 030664           44 LGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAK   87 (173)
Q Consensus        44 V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A~   87 (173)
                      |.+|+--.||.|..+- .+|.+....  ..+.++++++|+.-..
T Consensus         1 i~~f~d~~Cp~C~~~~-~~l~~~~~~--~~~~~~~~~~~~~~~~   41 (98)
T cd02972           1 IVEFFDPLCPYCYLFE-PELEKLLYA--DDGGVRVVYRPFPLLG   41 (98)
T ss_pred             CeEEECCCCHhHHhhh-HHHHHHHhh--cCCcEEEEEeccccCC
Confidence            4678889999999995 567777643  6788999999987554


No 9  
>PF14595 Thioredoxin_9:  Thioredoxin; PDB: 1Z6N_A.
Probab=86.43  E-value=1.4  Score=33.67  Aligned_cols=44  Identities=16%  Similarity=0.190  Sum_probs=25.9

Q ss_pred             CCCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEee
Q 030664           37 DVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWG   84 (173)
Q Consensus        37 ~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G   84 (173)
                      ....++++.|+.|+=||||++++ =.|..+.+   ..+.++++++.-.
T Consensus        38 ~~~~~~~ilvi~e~WCgD~~~~v-P~l~kiae---~~p~i~~~~i~rd   81 (129)
T PF14595_consen   38 SIQKPYNILVITETWCGDCARNV-PVLAKIAE---ANPNIEVRIILRD   81 (129)
T ss_dssp             T--S-EEEEEE--TT-HHHHHHH-HHHHHHHH---H-TTEEEEEE-HH
T ss_pred             hcCCCcEEEEEECCCchhHHHHH-HHHHHHHH---hCCCCeEEEEEec
Confidence            45677899999999999999885 23444443   3446788887654


No 10 
>cd03025 DsbA_FrnE_like DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE. FrnE is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.
Probab=86.41  E-value=1.4  Score=34.32  Aligned_cols=127  Identities=15%  Similarity=0.097  Sum_probs=70.9

Q ss_pred             eEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeeeeeecC-------------------CCceeecCChh
Q 030664           42 VKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAKIRAN-------------------NSTFDCQHGPS  102 (173)
Q Consensus        42 V~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A~~~~~-------------------~~~f~CQHG~~  102 (173)
                      ++|.+|+.-+||.|-.. ..+|..+...  +...++|++.+++=......                   ..+..-+.++.
T Consensus         1 ~~i~~~~D~~cp~c~~~-~~~l~~l~~~--~~~~~~v~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~   77 (193)
T cd03025           1 LELYYFIDPLCGWCYGF-EPLLEKLKEE--YGGGIEVELHLGGLLPGNNARQITKQWRIYVHWHKARIALTGQPFGEDYL   77 (193)
T ss_pred             CeEEEEECCCCchhhCc-hHHHHHHHHH--hCCCceEEEEeccccCCCCCCCcchHHHHHHhHHHHHHHhcCCccCchhH
Confidence            46899999999999877 3456666554  54568888888764332111                   00011111111


Q ss_pred             hhh---cChhhhhhhccc-c--ccccccceeecccccc-----cccccchHHhHHhhcCCCchhhhcccCCchhhHHHHh
Q 030664          103 ECL---LNTVEACAIDSW-P--ELNKHFPFIYCIESLV-----YEHKYSQWETCFDKLELDPKPIVDCYTSGYGTQVSLA  171 (173)
Q Consensus       103 EC~---gN~~qaCai~~~-~--~~~~~l~fI~Cm~~~~-----~~~~~~~~~~Ca~~~gld~~~I~~C~~~~~G~~Ll~~  171 (173)
                      +=.   .|...++..-.. .  ......+|..-+....     +.+..+.....+.+.|+|.+.+.++.++++.++.+.+
T Consensus        78 ~~~~~~~~s~~a~~~~~aa~~~~~~~~~~~~~~l~~a~~~~~~~i~~~~~l~~ia~~~Gld~~~~~~~~~s~~~~~~l~~  157 (193)
T cd03025          78 ELLLFDLDSAPASRAIKAARLQGPERLLEMLKAIQRAHYVEGRDLADTEVLRELAIELGLDVEEFLEDFQSDEAKQAIQE  157 (193)
T ss_pred             hcccCCCCchHHHHHHHHHHHhCcchHHHHHHHHHHHHHHcCCCCCCHHHHHHHHHHcCCCHHHHHHHHcChHHHHHHHH
Confidence            000   122323322111 1  1224455655554321     1122335678899999999999999998888777665


No 11 
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1. This protein is homologous to a family of proteins that includes thioredoxins, glutaredoxins, protein-disulfide isomerases, and others, some of which have several such domains. The sequence of this protein at the redox-active disufide site, CPYC, matches glutaredoxins rather than thioredoxins, although its overall sequence seems closer to thioredoxins. It is suggested to be a ribonucleotide-reducing system component distinct from thioredoxin or glutaredoxin.
Probab=83.90  E-value=2.6  Score=28.04  Aligned_cols=26  Identities=23%  Similarity=0.513  Sum_probs=19.9

Q ss_pred             eEEEEEEEeCChhhHHHHHHhHHHHHh
Q 030664           42 VKLGLYYESLCPYSANFIINYLVKIFE   68 (173)
Q Consensus        42 V~V~vyyESlCPd~~~Fi~~qL~P~~~   68 (173)
                      |+|++|+-+-||.|+... ..|..+..
T Consensus         1 ~~v~~f~~~~C~~C~~~~-~~l~~l~~   26 (82)
T TIGR00411         1 VKIELFTSPTCPYCPAAK-RVVEEVAK   26 (82)
T ss_pred             CEEEEEECCCCcchHHHH-HHHHHHHH
Confidence            789999999999999773 34444443


No 12 
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). All members contain a redox-active CXXC motif and may function as PDOs. The archaeal proteins Mj0307 and Mt807 show structures more similar to GRX, but activities more similar to TRX. Some members of the family are similar to PfPDO in that they contain a second CXXC motif located in a second TRX-fold subdomain at the N-terminus; the superimposable N- and C-terminal TRX subdomains form a compact structure. PfPDO is postulated to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI). The C-terminal CXXC motif of PfPDO is required for its oxidase, reductase and isomerase activities. Also included in the family is the C-terminal TRX-fold subdomain of the N-terminal domain (NTD) of bacteri
Probab=83.50  E-value=2.6  Score=27.27  Aligned_cols=17  Identities=24%  Similarity=0.755  Sum_probs=15.6

Q ss_pred             eEEEEEEEeCChhhHHH
Q 030664           42 VKLGLYYESLCPYSANF   58 (173)
Q Consensus        42 V~V~vyyESlCPd~~~F   58 (173)
                      |+|.+|+-+-||.|++.
T Consensus         1 ~~v~~f~~~~C~~C~~~   17 (67)
T cd02973           1 VNIEVFVSPTCPYCPDA   17 (67)
T ss_pred             CEEEEEECCCCCCcHHH
Confidence            78999999999999876


No 13 
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only]
Probab=82.79  E-value=0.51  Score=37.75  Aligned_cols=76  Identities=13%  Similarity=0.149  Sum_probs=44.7

Q ss_pred             cCCCCCCCCCCCCCCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCce-eeEEEEEeeeeeeecC-CCceeecCChh
Q 030664           25 SGSVSASRTSPSDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSI-VDLHLSPWGNAKIRAN-NSTFDCQHGPS  102 (173)
Q Consensus        25 ~~~~~~~~~~~~~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~-vdl~lvP~G~A~~~~~-~~~f~CQHG~~  102 (173)
                      .+.++..+-....=..||-+-.|--.-||+||.| +-.|.++|+.  +.+- =.|++|-.-.=+...+ ..-+.++||+-
T Consensus        18 ~~~~~~~~~~~~~l~gKvV~lyFsA~wC~pCR~F-TP~Lk~fYe~--l~~~~~~fEVvfVS~D~~~~~~~~y~~~~~~~W   94 (157)
T KOG2501|consen   18 RKQDGTEVLASEALQGKVVGLYFSAHWCPPCRDF-TPILKDFYEE--LKDNAAPFEVVFVSSDRDEESLDEYMLEHHGDW   94 (157)
T ss_pred             eccCCccchHhHhhCCcEEEEEEEEEECCchhhC-CchHHHHHHH--HHhcCCceEEEEEecCCCHHHHHHHHHhcCCCe
Confidence            4555555544434455776666667789999999 5678888876  5443 1455554322211110 13568888875


Q ss_pred             h
Q 030664          103 E  103 (173)
Q Consensus       103 E  103 (173)
                      =
T Consensus        95 ~   95 (157)
T KOG2501|consen   95 L   95 (157)
T ss_pred             E
Confidence            3


No 14 
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins. DsbC and DsbG are kept in their reduced state by the cytoplasmic membrane protein DsbD, which utilizes the TRX/TRX reductase system in the cytosol as a source of reducing equivalents. DsbG differ from DsbC in that it has a more limited substrate specificity, and it may preferentially act later in the folding process to catalyze disulfide rearrangements in folded or partially folded proteins. Also included in the alignment is the predicted protein TrbB, whose gene was sequenced from the enterohemorrhagic E. coli type IV pilus gene cluster, which is required for efficient plasmid transfer.
Probab=81.61  E-value=3.3  Score=32.98  Aligned_cols=44  Identities=18%  Similarity=0.191  Sum_probs=33.0

Q ss_pred             CCCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeeee
Q 030664           37 DVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAK   87 (173)
Q Consensus        37 ~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A~   87 (173)
                      ..+.++.|.+|.--.||+|+++- ..|.+      ..+-+.|+++||.-..
T Consensus        74 ~~~~~~~i~~f~D~~Cp~C~~~~-~~l~~------~~~~v~v~~~~~p~~~  117 (197)
T cd03020          74 KGNGKRVVYVFTDPDCPYCRKLE-KELKP------NADGVTVRIFPVPILG  117 (197)
T ss_pred             CCCCCEEEEEEECCCCccHHHHH-HHHhh------ccCceEEEEEEcCcCC
Confidence            44578999999999999999995 44555      2345788888886443


No 15 
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides. AhpF contains an NTD containing two contiguous TRX-fold subdomains similar to Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO). It also contains a catalytic core similar to TRX reductase containing FAD and NADH binding domains with an active site disulfide. The proposed mechanism of action of AhpF is similar to a TRX/TRX reductase system. The flow of reducing equivalents goes from NADH - catalytic core of AhpF - NTD of AhpF - AhpC - peroxide substrates. The catalytic CXXC motif of the NTD of AhpF is contained in its C-terminal TRX subdomain.
Probab=71.60  E-value=9.5  Score=26.96  Aligned_cols=41  Identities=10%  Similarity=0.212  Sum_probs=27.2

Q ss_pred             CCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEE
Q 030664           38 VNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSP   82 (173)
Q Consensus        38 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP   82 (173)
                      =..+|+|.+|+-.-||+|...  .++..-+..  ..+.+++..+=
T Consensus        10 l~~pv~i~~F~~~~C~~C~~~--~~~~~~l~~--~~~~i~~~~vd   50 (89)
T cd03026          10 LNGPINFETYVSLSCHNCPDV--VQALNLMAV--LNPNIEHEMID   50 (89)
T ss_pred             cCCCEEEEEEECCCCCCcHHH--HHHHHHHHH--HCCCceEEEEE
Confidence            467899999999999999965  344444433  33345555544


No 16 
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known including human GRX1 and GRX2, as well as E. coli GRX1 and GRX3, which 
Probab=71.15  E-value=3.6  Score=25.99  Aligned_cols=16  Identities=31%  Similarity=0.696  Sum_probs=14.3

Q ss_pred             EEEEEEEeCChhhHHH
Q 030664           43 KLGLYYESLCPYSANF   58 (173)
Q Consensus        43 ~V~vyyESlCPd~~~F   58 (173)
                      +|.+|....||+|++.
T Consensus         1 ~v~ly~~~~Cp~C~~~   16 (72)
T cd02066           1 KVVVFSKSTCPYCKRA   16 (72)
T ss_pred             CEEEEECCCCHHHHHH
Confidence            4789999999999976


No 17 
>PF13905 Thioredoxin_8:  Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A ....
Probab=70.54  E-value=14  Score=25.17  Aligned_cols=42  Identities=17%  Similarity=0.298  Sum_probs=30.3

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCC--ceeeEEEEEee
Q 030664           40 SKVKLGLYYESLCPYSANFIINYLVKIFEDVDLL--SIVDLHLSPWG   84 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~--d~vdl~lvP~G   84 (173)
                      .|+.+-.|+-+-||.|++++ ..|..++++  +.  +-++|-.|...
T Consensus         1 gK~~ll~fwa~~c~~c~~~~-~~l~~l~~~--~~~~~~v~~v~Vs~d   44 (95)
T PF13905_consen    1 GKPVLLYFWASWCPPCKKEL-PKLKELYKK--YKKKDDVEFVFVSLD   44 (95)
T ss_dssp             TSEEEEEEE-TTSHHHHHHH-HHHHHHHHH--HTTTTTEEEEEEE-S
T ss_pred             CCEEEEEEECCCCHHHHHHH-HHHHHHHHH--hCCCCCEEEEEEEeC
Confidence            36788889999999999996 567777776  65  66666666654


No 18 
>PRK10954 periplasmic protein disulfide isomerase I; Provisional
Probab=69.33  E-value=15  Score=29.55  Aligned_cols=113  Identities=9%  Similarity=0.003  Sum_probs=58.9

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhH--HHHHhhccCCceeeEEEEEeeeeeeecCC--CceeecCChhhhhcC--hhhhh
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYL--VKIFEDVDLLSIVDLHLSPWGNAKIRANN--STFDCQHGPSECLLN--TVEAC  112 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL--~P~~~~~~l~d~vdl~lvP~G~A~~~~~~--~~f~CQHG~~EC~gN--~~qaC  112 (173)
                      ..+..|.-|+-=.||.|.+|-. .|  .+.|.+ .+.+-+.+..+|+--.......  .-+    --.+|.+.  +.+  
T Consensus        36 ~~~~~VvEffdy~CphC~~~~~-~l~~~~~~~~-~~~~~v~~~~~~~~f~~~~~~~~~~a~----~~a~~~~~~~k~~--  107 (207)
T PRK10954         36 AGEPQVLEFFSFYCPHCYQFEE-VYHVSDNVKK-KLPEGTKMTKYHVEFLGPLGKELTQAW----AVAMALGVEDKVT--  107 (207)
T ss_pred             CCCCeEEEEeCCCCccHHHhcc-cccchHHHHH-hCCCCCeEEEecccccchhhHHHHHHH----HHHHHhCcHHHHH--
Confidence            4567899999999999999943 33  366665 5666666666554211000000  000    00112111  110  


Q ss_pred             hhccccccccccceeecccccccccccchHHhHHhhcCCCchhhhcccCCchhhHHHH
Q 030664          113 AIDSWPELNKHFPFIYCIESLVYEHKYSQWETCFDKLELDPKPIVDCYTSGYGTQVSL  170 (173)
Q Consensus       113 ai~~~~~~~~~l~fI~Cm~~~~~~~~~~~~~~Ca~~~gld~~~I~~C~~~~~G~~Ll~  170 (173)
                              ...++.+  +... .....+....-+.+.|+|.+.+.+|.++..-.+.+.
T Consensus       108 --------~~lf~~i--~~~~-~~~~~~~L~~~a~~~Gld~~~f~~~l~s~~~~~~v~  154 (207)
T PRK10954        108 --------PPLFEGV--QKTQ-TIQSAADIRDVFIKAGVKGEDYDAAWNSFVVKSLVA  154 (207)
T ss_pred             --------HHHHHHH--HccC-CCCCHHHHHHHHHHcCCCHHHHHHHHhChHHHHHHH
Confidence                    0011111  1111 111223456778899999999999998866555443


No 19 
>TIGR02190 GlrX-dom Glutaredoxin-family domain. This C-terminal domain with homology to glutaredoxin is fused to an N-terminal peroxiredoxin-like domain.
Probab=68.47  E-value=4.3  Score=27.67  Aligned_cols=21  Identities=14%  Similarity=0.382  Sum_probs=17.3

Q ss_pred             CCCeeEEEEEEEeCChhhHHH
Q 030664           38 VNSKVKLGLYYESLCPYSANF   58 (173)
Q Consensus        38 ~~~kV~V~vyyESlCPd~~~F   58 (173)
                      ...+-+|+||.-+-||+|++-
T Consensus         4 ~~~~~~V~ly~~~~Cp~C~~a   24 (79)
T TIGR02190         4 ARKPESVVVFTKPGCPFCAKA   24 (79)
T ss_pred             cCCCCCEEEEECCCCHhHHHH
Confidence            344557999999999999987


No 20 
>TIGR02200 GlrX_actino Glutaredoxin-like protein. This family of glutaredoxin-like proteins is limited to the Actinobacteria and contains the conserved CxxC motif.
Probab=66.95  E-value=4.2  Score=26.58  Aligned_cols=16  Identities=25%  Similarity=0.646  Sum_probs=14.3

Q ss_pred             EEEEEEEeCChhhHHH
Q 030664           43 KLGLYYESLCPYSANF   58 (173)
Q Consensus        43 ~V~vyyESlCPd~~~F   58 (173)
                      +|.+|+-+-||+|++.
T Consensus         1 ~v~ly~~~~C~~C~~~   16 (77)
T TIGR02200         1 TITVYGTTWCGYCAQL   16 (77)
T ss_pred             CEEEEECCCChhHHHH
Confidence            4789999999999985


No 21 
>PRK10877 protein disulfide isomerase II DsbC; Provisional
Probab=66.25  E-value=15  Score=30.51  Aligned_cols=60  Identities=8%  Similarity=0.241  Sum_probs=37.4

Q ss_pred             CCCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeeeeeecC----CCceeecCChh
Q 030664           37 DVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAKIRAN----NSTFDCQHGPS  102 (173)
Q Consensus        37 ~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A~~~~~----~~~f~CQHG~~  102 (173)
                      ..+.++.|.+|.--.||+|+++- .+|.+ +.+  .  -+.+++++|.-....+.    ...+-|+..+.
T Consensus       104 ~~~~k~~I~vFtDp~CpyCkkl~-~~l~~-~~~--~--~v~v~~~~~P~~g~~~~a~~~a~~iwca~d~~  167 (232)
T PRK10877        104 APQEKHVITVFTDITCGYCHKLH-EQMKD-YNA--L--GITVRYLAFPRQGLDSQAEKDMKSIWCAADRN  167 (232)
T ss_pred             CCCCCEEEEEEECCCChHHHHHH-HHHHH-Hhc--C--CeEEEEEeccCCCCCchHHHHHHHHhcCCCHH
Confidence            34678889999999999999995 34443 332  1  26777776654322111    12567876553


No 22 
>PF01323 DSBA:  DSBA-like thioredoxin domain;  InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family []. The efficient and correct folding of bacterial disulphide bonded proteins in vivo is dependent upon a class of periplasmic oxidoreductase proteins called DsbA, after the Escherichia coli enzyme. The bacterial protein-folding factor DsbA is the most oxidizing of the thioredoxin family. DsbA catalyses disulphide-bond formation during the folding of secreted proteins. The extremely oxidizing nature of DsbA has been proposed to result from either domain motion or stabilising active-site interactions in the reduced form. DsbA's highly oxidizing nature is a result of hydrogen bond, electrostatic and helix-dipole interactions that favour the thiolate over the disulphide at the active site []. In the pathogenic bacterium Vibrio cholerae, the DsbA homologue (TcpG) is responsible for the folding, maturation and secretion of virulence factors. While the overall architecture of TcpG and DsbA is similar and the surface features are retained in TcpG, there are significant differences. For example, the kinked active site helix results from a three-residue loop in DsbA, but is caused by a proline in TcpG (making TcpG more similar to thioredoxin in this respect). Furthermore, the proposed peptide binding groove of TcpG is substantially shortened compared with that of DsbA due to a six-residue deletion. Also, the hydrophobic pocket of TcpG is more shallow and the acidic patch is much less extensive than that of E. coli DsbA [].; GO: 0015035 protein disulfide oxidoreductase activity; PDB: 3GL5_A 3DKS_D 3RPP_C 3RPN_B 1YZX_A 3L9V_C 2IMD_A 2IME_A 2IMF_A 2B3S_B ....
Probab=66.12  E-value=14  Score=28.54  Aligned_cols=38  Identities=16%  Similarity=0.457  Sum_probs=30.0

Q ss_pred             EEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEee
Q 030664           43 KLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWG   84 (173)
Q Consensus        43 ~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G   84 (173)
                      +|++|+.-.||.|-.+. ..|..+...  ..+ ++|++.|+.
T Consensus         1 ~i~~~~D~~Cp~cy~~~-~~l~~l~~~--~~~-~~i~~~p~~   38 (193)
T PF01323_consen    1 TIEFFFDFICPWCYLAS-PRLRKLRAE--YPD-VEIEWRPFP   38 (193)
T ss_dssp             EEEEEEBTTBHHHHHHH-HHHHHHHHH--HTT-CEEEEEEES
T ss_pred             CEEEEEeCCCHHHHHHH-HHHHHHHHH--hcC-CcEEEeccc
Confidence            58999999999999885 456666654  334 999999996


No 23 
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes
Probab=65.36  E-value=5.7  Score=26.44  Aligned_cols=16  Identities=25%  Similarity=0.644  Sum_probs=14.4

Q ss_pred             EEEEEEEeCChhhHHH
Q 030664           43 KLGLYYESLCPYSANF   58 (173)
Q Consensus        43 ~V~vyyESlCPd~~~F   58 (173)
                      +|.+|+...||+|++.
T Consensus         1 ~v~~y~~~~Cp~C~~~   16 (82)
T cd03419           1 PVVVFSKSYCPYCKRA   16 (82)
T ss_pred             CEEEEEcCCCHHHHHH
Confidence            4799999999999977


No 24 
>PF00462 Glutaredoxin:  Glutaredoxin;  InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system [].  Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond []. It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed [] that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro.  This entry represents Glutaredoxin.; GO: 0009055 electron carrier activity, 0015035 protein disulfide oxidoreductase activity, 0045454 cell redox homeostasis; PDB: 1QFN_A 1GRX_A 1EGO_A 1EGR_A 3RHC_A 3RHB_A 3IPZ_A 1NHO_A 3GX8_A 3D5J_A ....
Probab=62.67  E-value=6.7  Score=24.98  Aligned_cols=16  Identities=25%  Similarity=0.550  Sum_probs=14.3

Q ss_pred             EEEEEEeCChhhHHHH
Q 030664           44 LGLYYESLCPYSANFI   59 (173)
Q Consensus        44 V~vyyESlCPd~~~Fi   59 (173)
                      |.+|...-||+|++..
T Consensus         1 V~vy~~~~C~~C~~~~   16 (60)
T PF00462_consen    1 VVVYTKPGCPYCKKAK   16 (60)
T ss_dssp             EEEEESTTSHHHHHHH
T ss_pred             cEEEEcCCCcCHHHHH
Confidence            6899999999999874


No 25 
>PF13098 Thioredoxin_2:  Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A ....
Probab=60.62  E-value=20  Score=25.14  Aligned_cols=27  Identities=22%  Similarity=0.426  Sum_probs=19.0

Q ss_pred             CCCeeEEEEEEEeCChhhHHHHHHhHHH
Q 030664           38 VNSKVKLGLYYESLCPYSANFIINYLVK   65 (173)
Q Consensus        38 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P   65 (173)
                      ...|..|-+|+---||+|+++- .++.+
T Consensus         3 ~~~k~~v~~F~~~~C~~C~~~~-~~~~~   29 (112)
T PF13098_consen    3 GNGKPIVVVFTDPWCPYCKKLE-KELFP   29 (112)
T ss_dssp             TTSSEEEEEEE-TT-HHHHHHH-HHHHH
T ss_pred             CCCCEEEEEEECCCCHHHHHHH-HHHHH
Confidence            3466778888999999999984 45655


No 26 
>TIGR02180 GRX_euk Glutaredoxin. This model represents eukaryotic glutaredoxins and includes sequences from fungi, plants and metazoans as well as viruses.
Probab=60.39  E-value=6.4  Score=26.19  Aligned_cols=16  Identities=25%  Similarity=0.623  Sum_probs=14.1

Q ss_pred             EEEEEEeCChhhHHHH
Q 030664           44 LGLYYESLCPYSANFI   59 (173)
Q Consensus        44 V~vyyESlCPd~~~Fi   59 (173)
                      |.+|+.+.||+|++..
T Consensus         1 V~~f~~~~Cp~C~~~~   16 (84)
T TIGR02180         1 VVVFSKSYCPYCKKAK   16 (84)
T ss_pred             CEEEECCCChhHHHHH
Confidence            5799999999999874


No 27 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=59.20  E-value=6.8  Score=28.66  Aligned_cols=28  Identities=18%  Similarity=0.131  Sum_probs=13.0

Q ss_pred             CCCCccchhHHHHHHHHHHHhccccCCCC
Q 030664            1 MASSSYSSTKALSLVFYITLFCFLSGSVS   29 (173)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   29 (173)
                      |+|-.++ .+++++..+|+|++-.|+.+-
T Consensus         1 MaSK~~l-lL~l~LA~lLlisSevaa~~~   28 (95)
T PF07172_consen    1 MASKAFL-LLGLLLAALLLISSEVAAREL   28 (95)
T ss_pred             CchhHHH-HHHHHHHHHHHHHhhhhhHHh
Confidence            7755433 333344444555544444433


No 28 
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known i
Probab=58.85  E-value=6.6  Score=25.78  Aligned_cols=16  Identities=31%  Similarity=0.762  Sum_probs=14.4

Q ss_pred             EEEEEEEeCChhhHHH
Q 030664           43 KLGLYYESLCPYSANF   58 (173)
Q Consensus        43 ~V~vyyESlCPd~~~F   58 (173)
                      +|.+|.-+.||+|.+.
T Consensus         1 ~i~ly~~~~Cp~C~~a   16 (75)
T cd03418           1 KVEIYTKPNCPYCVRA   16 (75)
T ss_pred             CEEEEeCCCChHHHHH
Confidence            4789999999999987


No 29 
>cd03024 DsbA_FrnE DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.
Probab=58.30  E-value=20  Score=27.99  Aligned_cols=125  Identities=14%  Similarity=0.074  Sum_probs=69.9

Q ss_pred             EEEEEEeCChhhHHHHHHhHHHHHhhccCC--ceeeEEEEEeeeeeeecCCC-----ceeecCChh--------------
Q 030664           44 LGLYYESLCPYSANFIINYLVKIFEDVDLL--SIVDLHLSPWGNAKIRANNS-----TFDCQHGPS--------------  102 (173)
Q Consensus        44 V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~--d~vdl~lvP~G~A~~~~~~~-----~f~CQHG~~--------------  102 (173)
                      |++|+--.||.|--. ..+|..+...  +.  +-++|++.||+-.......+     .+.=+||..              
T Consensus         1 I~~~~D~~cP~cyl~-~~~l~~~~~~--~~~~~~~~v~~~p~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~a   77 (201)
T cd03024           1 IDIWSDVVCPWCYIG-KRRLEKALAE--LGDEVDVEIEWRPFELNPDMPPEGEDRREYLARKYGSTAEQAAAMRRVEAAA   77 (201)
T ss_pred             CeEEecCcCccHHHH-HHHHHHHHHh--CCCCCceEEEEeeeeeCCCCCCCCCCHHHHHHHHhCCCHHHHHHHHHHHHHH
Confidence            579999999999877 4567777664  53  35999999996432211100     011011110              


Q ss_pred             -----------hhhcChhhhhhhccc-cccccccceeecccccc-----cccccchHHhHHhhcCCCchhhhcccCCchh
Q 030664          103 -----------ECLLNTVEACAIDSW-PELNKHFPFIYCIESLV-----YEHKYSQWETCFDKLELDPKPIVDCYTSGYG  165 (173)
Q Consensus       103 -----------EC~gN~~qaCai~~~-~~~~~~l~fI~Cm~~~~-----~~~~~~~~~~Ca~~~gld~~~I~~C~~~~~G  165 (173)
                                 .-..|...++.+-.. .......+|..=+....     +....+.....|+..|+|.+.+.++.++++.
T Consensus        78 ~~~gi~~~~~~~~~~~s~~a~~~~~~a~~~~~~~~~~~~lf~a~~~~~~~i~~~~~l~~~a~~~Gld~~~~~~~~~~~~~  157 (201)
T cd03024          78 AAEGLEFDFDRVRPPNTFDAHRLIHLAKEQGKQDALVEALFRAYFTEGKDIGDRDVLVDLAEEAGLDAAEARAVLASDEY  157 (201)
T ss_pred             HHcCCcccCCCCccCCcHHHHHHHHHHhccCcHHHHHHHHHHHHHccCCCCCCHHHHHHHHHHcCCCHHHHHHHhcCccc
Confidence                       001244444432221 11223445544443321     1122334668899999999999999998877


Q ss_pred             hHHHHh
Q 030664          166 TQVSLA  171 (173)
Q Consensus       166 ~~Ll~~  171 (173)
                      ++.+.+
T Consensus       158 ~~~~~~  163 (201)
T cd03024         158 ADEVRA  163 (201)
T ss_pred             chHHHH
Confidence            665554


No 30 
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains. The TRX domain functions as a protein disulfide reductase via the reversible oxidation of an active center dithiol present in a CXXC motif, while the NTR domain functions as a reductant to oxidized TRX. The fusion protein is  bifunctional, showing both TRX and NTR activities, but it is not an independent NTR/TRX system. In plants, the protein is found exclusively in shoots and mature leaves and is localized in the chloroplast. It is involved in plant protection against oxidative stress.
Probab=58.24  E-value=33  Score=23.71  Aligned_cols=34  Identities=18%  Similarity=0.294  Sum_probs=25.3

Q ss_pred             CCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCc
Q 030664           38 VNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLS   74 (173)
Q Consensus        38 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d   74 (173)
                      ..+++-+-+|+-+-||.|+.+. ..|-++.+.  +.+
T Consensus        11 ~~~~~vlv~f~a~~C~~C~~~~-~~l~~l~~~--~~~   44 (97)
T cd02949          11 ESDRLILVLYTSPTCGPCRTLK-PILNKVIDE--FDG   44 (97)
T ss_pred             hCCCeEEEEEECCCChhHHHHH-HHHHHHHHH--hCC
Confidence            4677888899999999999985 345555544  554


No 31 
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions.  GRX is a glutathione (GSH) dependent reductase containing a redox active CXXC motif in a TRX fold. It has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. By altering the redox state of target proteins, GRX is involved in many cellular functions.
Probab=57.50  E-value=11  Score=24.96  Aligned_cols=17  Identities=12%  Similarity=0.243  Sum_probs=15.1

Q ss_pred             EEEEEEEeCChhhHHHH
Q 030664           43 KLGLYYESLCPYSANFI   59 (173)
Q Consensus        43 ~V~vyyESlCPd~~~Fi   59 (173)
                      +|+||.-+.||+|++-.
T Consensus         2 ~v~ly~~~~C~~C~ka~   18 (73)
T cd03027           2 RVTIYSRLGCEDCTAVR   18 (73)
T ss_pred             EEEEEecCCChhHHHHH
Confidence            58899999999999873


No 32 
>COG1651 DsbG Protein-disulfide isomerase [Posttranslational modification, protein turnover, chaperones]
Probab=56.64  E-value=36  Score=27.68  Aligned_cols=23  Identities=17%  Similarity=0.502  Sum_probs=18.9

Q ss_pred             CCCCeeEEEEEEEeCChhhHHHH
Q 030664           37 DVNSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        37 ~~~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      ....+|.|.+|.+=.||.|++.+
T Consensus        81 ~~~~~v~v~~f~d~~Cp~C~~~~  103 (244)
T COG1651          81 NPYAPVTVVEFFDYTCPYCKEAF  103 (244)
T ss_pred             CCCCCceEEEEecCcCccHHHHH
Confidence            34449999999999999996654


No 33 
>KOG3425 consensus Uncharacterized conserved protein [Function unknown]
Probab=56.42  E-value=17  Score=28.17  Aligned_cols=36  Identities=17%  Similarity=0.134  Sum_probs=24.4

Q ss_pred             EeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeeee
Q 030664           49 ESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAK   87 (173)
Q Consensus        49 ESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A~   87 (173)
                      +|=||||++. .-.+..+++.  ...-+.|-.|.-|+--
T Consensus        42 qSWCPdCV~A-EPvi~~alk~--ap~~~~~v~v~VG~rp   77 (128)
T KOG3425|consen   42 QSWCPDCVAA-EPVINEALKH--APEDVHFVHVYVGNRP   77 (128)
T ss_pred             CcCCchHHHh-hHHHHHHHHh--CCCceEEEEEEecCCC
Confidence            4559999987 3344555654  6777777777777653


No 34 
>PF13728 TraF:  F plasmid transfer operon protein
Probab=55.57  E-value=11  Score=31.24  Aligned_cols=40  Identities=23%  Similarity=0.446  Sum_probs=30.4

Q ss_pred             CCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEee
Q 030664           38 VNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWG   84 (173)
Q Consensus        38 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G   84 (173)
                      -.++.-+-++|+|-||.|+.|     .|++..  +.+.-.|+++|+-
T Consensus       118 la~~~gL~~F~~~~C~~C~~~-----~pil~~--~~~~yg~~v~~vs  157 (215)
T PF13728_consen  118 LAQKYGLFFFYRSDCPYCQQQ-----APILQQ--FADKYGFSVIPVS  157 (215)
T ss_pred             HhhCeEEEEEEcCCCchhHHH-----HHHHHH--HHHHhCCEEEEEe
Confidence            346778999999999999976     455554  6666688888864


No 35 
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family. This glutaredoxin-like protein family contains the conserved CxxC motif and includes the Clostridium pasteurianum protein YruB which has been cloned from a rubredoxin operon. Somewhat related to NrdH, it is unknown whether this protein actually interacts with glutathione/glutathione reducatase, or, like NrdH, some other reductant system.
Probab=54.92  E-value=7.5  Score=24.67  Aligned_cols=16  Identities=25%  Similarity=0.530  Sum_probs=14.1

Q ss_pred             EEEEEEEeCChhhHHH
Q 030664           43 KLGLYYESLCPYSANF   58 (173)
Q Consensus        43 ~V~vyyESlCPd~~~F   58 (173)
                      +|++|+-+-||.|++.
T Consensus         1 ~i~lf~~~~C~~C~~~   16 (74)
T TIGR02196         1 KVKVYTTPWCPPCKKA   16 (74)
T ss_pred             CEEEEcCCCChhHHHH
Confidence            3789999999999975


No 36 
>PRK13728 conjugal transfer protein TrbB; Provisional
Probab=54.57  E-value=11  Score=30.62  Aligned_cols=34  Identities=21%  Similarity=0.531  Sum_probs=24.3

Q ss_pred             EEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEee
Q 030664           44 LGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWG   84 (173)
Q Consensus        44 V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G   84 (173)
                      |-+||.|-||.|++++ -.|..+.++  .    .++++++.
T Consensus        73 lV~FwaswCp~C~~e~-P~L~~l~~~--~----g~~Vi~Vs  106 (181)
T PRK13728         73 VVLFMQGHCPYCHQFD-PVLKQLAQQ--Y----GFSVFPYT  106 (181)
T ss_pred             EEEEECCCCHhHHHHH-HHHHHHHHH--c----CCEEEEEE
Confidence            7789999999999995 234444443  3    47777774


No 37 
>PRK13703 conjugal pilus assembly protein TraF; Provisional
Probab=54.32  E-value=9.4  Score=32.58  Aligned_cols=38  Identities=16%  Similarity=0.350  Sum_probs=29.0

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEee
Q 030664           40 SKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWG   84 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G   84 (173)
                      ++--+-++|+|-||.|+.|     .|++..  +.+.-.+.++|+-
T Consensus       143 ~~~GL~fFy~s~Cp~C~~~-----aPil~~--fa~~yg~~v~~VS  180 (248)
T PRK13703        143 EHYGLMFFYRGQDPIDGQL-----AQVIND--FRDTYGLSVIPVS  180 (248)
T ss_pred             hcceEEEEECCCCchhHHH-----HHHHHH--HHHHhCCeEEEEe
Confidence            3456889999999999966     466665  6677778888874


No 38 
>PRK11200 grxA glutaredoxin 1; Provisional
Probab=53.80  E-value=10  Score=25.93  Aligned_cols=22  Identities=18%  Similarity=0.297  Sum_probs=17.4

Q ss_pred             EEEEEEEeCChhhHHHHHHhHHH
Q 030664           43 KLGLYYESLCPYSANFIINYLVK   65 (173)
Q Consensus        43 ~V~vyyESlCPd~~~Fi~~qL~P   65 (173)
                      +|++|+-+-||.|++.. +.|..
T Consensus         2 ~v~iy~~~~C~~C~~a~-~~L~~   23 (85)
T PRK11200          2 FVVIFGRPGCPYCVRAK-ELAEK   23 (85)
T ss_pred             EEEEEeCCCChhHHHHH-HHHHh
Confidence            68999999999999873 34443


No 39 
>PHA03050 glutaredoxin; Provisional
Probab=53.21  E-value=9  Score=28.24  Aligned_cols=16  Identities=25%  Similarity=0.688  Sum_probs=14.7

Q ss_pred             EEEEEEEeCChhhHHH
Q 030664           43 KLGLYYESLCPYSANF   58 (173)
Q Consensus        43 ~V~vyyESlCPd~~~F   58 (173)
                      +|.||.-+-||+|++-
T Consensus        14 ~V~vys~~~CPyC~~a   29 (108)
T PHA03050         14 KVTIFVKFTCPFCRNA   29 (108)
T ss_pred             CEEEEECCCChHHHHH
Confidence            5899999999999976


No 40 
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase activity that is dependent on TRX reductase, not glutathione (GSH). It is part of the NrdHIEF operon, where NrdEF codes for class Ib ribonucleotide reductase (RNR-Ib), an efficient enzyme at low oxygen levels. Under these conditions when GSH is mostly conjugated to spermidine, NrdH can still function and act as a hydrogen donor for RNR-Ib. It has been suggested that the NrdHEF system may be the oldest RNR reducing system, capable of functioning in a microaerophilic environment, where GSH was not yet available. NrdH from Corynebacterium ammoniagenes can form domain-swapped dimers, although it is unknown if this happens in vivo. Domain-swapped dimerization, which results in the blocking of the TRX reductase binding site, cou
Probab=53.06  E-value=11  Score=23.85  Aligned_cols=16  Identities=25%  Similarity=0.652  Sum_probs=14.1

Q ss_pred             EEEEEEEeCChhhHHH
Q 030664           43 KLGLYYESLCPYSANF   58 (173)
Q Consensus        43 ~V~vyyESlCPd~~~F   58 (173)
                      +|++|+.+-||+|++.
T Consensus         1 ~v~l~~~~~c~~c~~~   16 (73)
T cd02976           1 EVTVYTKPDCPYCKAT   16 (73)
T ss_pred             CEEEEeCCCChhHHHH
Confidence            4789999999999985


No 41 
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif. TryX is involved in the regulation of oxidative stress in parasitic trypanosomatids by reducing TryX peroxidase, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides. TryX derives reducing equivalents from reduced trypanothione, a polyamine peptide conjugate unique to trypanosomatids, which is regenerated by the NADPH-dependent flavoprotein trypanothione reductase. Vertebrate NRX is a 400-amino acid nuclear protein with one redox active TRX domain containing a CPPC active site motif followed by one redox inactive TRX-like domain. Mouse NRX transcripts are expressed in all adult tissues but is restricted to the nervous system and limb buds in embryos. Plant NRX, longer than the 
Probab=52.61  E-value=30  Score=25.10  Aligned_cols=41  Identities=22%  Similarity=0.293  Sum_probs=26.3

Q ss_pred             CCCCCCCCCCCCCCeeEEEEEEEeCChhhHHHHHHhHHHHHhh
Q 030664           27 SVSASRTSPSDVNSKVKLGLYYESLCPYSANFIINYLVKIFED   69 (173)
Q Consensus        27 ~~~~~~~~~~~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~   69 (173)
                      .+++... ++.-..|+-|-.+|-+-||.|++.+ ..|..++++
T Consensus         6 ~~G~~v~-l~~~~gk~vll~Fwa~wC~~C~~~~-p~l~~~~~~   46 (131)
T cd03009           6 NDGGKVP-VSSLEGKTVGLYFSASWCPPCRAFT-PKLVEFYEK   46 (131)
T ss_pred             cCCCCcc-HHHhCCcEEEEEEECCCChHHHHHh-HHHHHHHHH
Confidence            3454444 3344567777778889999999874 345555543


No 42 
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1. PDI, ERp72 and ERp57 are endoplasmic reticulum (ER)-resident eukaryotic proteins involved in oxidative protein folding. They are oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. PDI and ERp57 have the abb'a' domain structure (where a and a' are redox active TRX domains while b and b' are redox inactive TRX-like domains). PDI also contains an acidic region (c domain) after the a' domain that is absent in ERp57. ERp72 has an additional a domain at the N-terminus (a"abb'a' domain structure). ERp57 interacts with the lectin chaperones, calnexin and calreticu
Probab=52.52  E-value=35  Score=23.19  Aligned_cols=38  Identities=16%  Similarity=0.183  Sum_probs=24.5

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEE
Q 030664           40 SKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHL   80 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~l   80 (173)
                      .+.-+-.||-+-|+.|+++. .++..+-..  +.+..++.+
T Consensus        18 ~~~~~v~f~~~~C~~C~~~~-~~~~~~~~~--~~~~~~~~~   55 (104)
T cd02995          18 DKDVLVEFYAPWCGHCKALA-PIYEELAEK--LKGDDNVVI   55 (104)
T ss_pred             CCcEEEEEECCCCHHHHHHh-hHHHHHHHH--hcCCCCEEE
Confidence            35667788999999999874 345555443  555434444


No 43 
>TIGR02189 GlrX-like_plant Glutaredoxin-like family. This family of glutaredoxin-like proteins is aparrently limited to plants. Multiple isoforms are found in A. thaliana and O.sativa.
Probab=52.06  E-value=9.6  Score=27.43  Aligned_cols=17  Identities=12%  Similarity=0.157  Sum_probs=15.2

Q ss_pred             EEEEEEEeCChhhHHHH
Q 030664           43 KLGLYYESLCPYSANFI   59 (173)
Q Consensus        43 ~V~vyyESlCPd~~~Fi   59 (173)
                      +|.||.-+.||+|++.-
T Consensus         9 ~Vvvysk~~Cp~C~~ak   25 (99)
T TIGR02189         9 AVVIFSRSSCCMCHVVK   25 (99)
T ss_pred             CEEEEECCCCHHHHHHH
Confidence            58999999999999873


No 44 
>TIGR02181 GRX_bact Glutaredoxin, GrxC family. This family of glutaredoxins includes the E. coli protein GrxC (Grx3) which appears to have a secondary role in reducing ribonucleotide reductase (in the absence of GrxA) possibly indicating a role in the reduction of other protein disulfides.
Probab=51.76  E-value=9  Score=25.63  Aligned_cols=15  Identities=27%  Similarity=0.813  Sum_probs=13.6

Q ss_pred             EEEEEEeCChhhHHH
Q 030664           44 LGLYYESLCPYSANF   58 (173)
Q Consensus        44 V~vyyESlCPd~~~F   58 (173)
                      |++|..+-||+|.+-
T Consensus         1 v~ly~~~~Cp~C~~a   15 (79)
T TIGR02181         1 VTIYTKPYCPYCTRA   15 (79)
T ss_pred             CEEEecCCChhHHHH
Confidence            689999999999976


No 45 
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional
Probab=51.14  E-value=17  Score=33.43  Aligned_cols=25  Identities=8%  Similarity=0.271  Sum_probs=20.9

Q ss_pred             CCCCCCeeEEEEEEEeCChhhHHHH
Q 030664           35 PSDVNSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        35 ~~~~~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      ...-+.++.|++|+-.-||+|.+.+
T Consensus       111 i~~~~~~~~i~~fv~~~Cp~Cp~~v  135 (517)
T PRK15317        111 IKALDGDFHFETYVSLSCHNCPDVV  135 (517)
T ss_pred             HHhcCCCeEEEEEEcCCCCCcHHHH
Confidence            3445678999999999999999764


No 46 
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX. Most members of this family, except RdCVF, are protein disulfide oxidoreductases containing an active site CXXC motif, similar to TRX.
Probab=50.38  E-value=35  Score=25.05  Aligned_cols=46  Identities=22%  Similarity=0.270  Sum_probs=29.4

Q ss_pred             CCCCCCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCce-eeEEEEE
Q 030664           34 SPSDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSI-VDLHLSP   82 (173)
Q Consensus        34 ~~~~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~-vdl~lvP   82 (173)
                      +++.-..|+-|-.++-+-||.|++.+. .|..++++  +.+. -+++++.
T Consensus        11 ~l~~~~Gk~vll~F~atwC~~C~~~~p-~l~~l~~~--~~~~~~~v~vi~   57 (132)
T cd02964          11 PVSALEGKTVGLYFSASWCPPCRAFTP-KLVEFYEK--LKEEGKNFEIVF   57 (132)
T ss_pred             cHHHhCCCEEEEEEECCCCchHHHHHH-HHHHHHHH--HhhcCCCeEEEE
Confidence            344545688888888999999999753 45555554  4332 2344443


No 47 
>PF00085 Thioredoxin:  Thioredoxin;  InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms. Thioredoxin serves as a general protein disulphide oxidoreductase. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. In the NADPH-dependent protein disulphide reduction, thioredoxin reductase (TR) catalyses the reduction of oxidised thioredoxin (trx) by NADPH using FAD and its redox-active disulphide; reduced thioredoxin then directly reduces the disulphide in the substrate protein [].  Thioredoxin is present in prokaryotes and eukaryotes and the sequence around the redox-active disulphide bond is well conserved. All thioredoxins contain a cis-proline located in a loop preceding beta-strand 4, which makes contact with the active site cysteines, and is important for stability and function []. Thioredoxin belongs to a structural family that includes glutaredoxin, glutathione peroxidase, bacterial protein disulphide isomerase DsbA, and the N-terminal domain of glutathione transferase []. Thioredoxins have a beta-alpha unit preceding the motif common to all these proteins.  A number of eukaryotic proteins contain domains evolutionary related to thioredoxin, most of them are protein disulphide isomerases (PDI). PDI (5.3.4.1 from EC) [, , ] is an endoplasmic reticulum multi-functional enzyme that catalyses the formation and rearrangement of disulphide bonds during protein folding []. All PDI contains two or three (ERp72) copies of the thioredoxin domain, each of which contributes to disulphide isomerase activity, but which are functionally non-equivalent []. Moreover, PDI exhibits chaperone-like activity towards proteins that contain no disulphide bonds, i.e. behaving independently of its disulphide isomerase activity []. The various forms of PDI which are currently known are:   PDI major isozyme; a multifunctional protein that also function as the beta subunit of prolyl 4-hydroxylase (1.14.11.2 from EC), as a component of oligosaccharyl transferase (2.4.1.119 from EC), as thyroxine deiodinase (3.8.1.4 from EC), as glutathione-insulin transhydrogenase (1.8.4.2 from EC) and as a thyroid hormone-binding protein ERp60 (ER-60; 58 Kd microsomal protein). ERp60 was originally thought to be a phosphoinositide-specific phospholipase C isozyme and later to be a protease. ERp72. ERp5.    Bacterial proteins that act as thiol:disulphide interchange proteins that allows disulphide bond formation in some periplasmic proteins also contain a thioredoxin domain. These proteins include:    Escherichia coli DsbA (or PrfA) and its orthologs in Vibrio cholerae (TtcpG) and Haemophilus influenzae (Por). E. coli DsbC (or XpRA) and its orthologues in Erwinia chrysanthemi and H. influenzae. E. coli DsbD (or DipZ) and its H. influenzae orthologue. E. coli DsbE (or CcmG) and orthologues in H. influenzae.  Rhodobacter capsulatus (Rhodopseudomonas capsulata) (HelX), Rhiziobiacae (CycY and TlpA).   This entry represents the thioredoxin domain.; GO: 0045454 cell redox homeostasis; PDB: 3ED3_B 1EP7_A 1EP8_B 1TOF_A 2OE3_B 2OE1_B 2OE0_B 1V98_A 3H79_A 3CXG_A ....
Probab=49.43  E-value=33  Score=23.14  Aligned_cols=32  Identities=22%  Similarity=0.398  Sum_probs=22.3

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCc
Q 030664           40 SKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLS   74 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d   74 (173)
                      ++.-|-.+|...||.|+++. ..+..+...  +.+
T Consensus        17 ~~~vvv~f~~~~C~~C~~~~-~~~~~~~~~--~~~   48 (103)
T PF00085_consen   17 DKPVVVYFYAPWCPPCKAFK-PILEKLAKE--YKD   48 (103)
T ss_dssp             SSEEEEEEESTTSHHHHHHH-HHHHHHHHH--TTT
T ss_pred             CCCEEEEEeCCCCCcccccc-ceecccccc--ccc
Confidence            46677778889999999983 445555543  555


No 48 
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold. Many members contain a classic TRX domain with a redox active CXXC motif. They function as protein disulfide oxidoreductases (PDOs), altering the redox state of target proteins via the reversible oxidation of their active site dithiol. The PDO members of this superfamily include TRX, protein disulfide isomerase (PDI), tlpA-like, glutaredoxin, NrdH redoxin, and the bacterial Dsb (DsbA, DsbC, DsbG, DsbE, DsbDgamma) protein families. Members of the superfamily that do not function as PDOs but contain a TRX-fold domain include phosducins, peroxiredoxins and glutathione (GSH) peroxidases, SCO proteins, GSH transferases (GST, N-terminal domain), arsenic reductases, TRX-like ferredoxins and calsequestrin, among others.
Probab=47.76  E-value=42  Score=19.12  Aligned_cols=35  Identities=23%  Similarity=0.409  Sum_probs=20.9

Q ss_pred             EEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEE
Q 030664           44 LGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSP   82 (173)
Q Consensus        44 V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP   82 (173)
                      |.+|+.+-||.|++.. .++... ..  ..+.+++..+.
T Consensus         1 l~~~~~~~c~~c~~~~-~~~~~~-~~--~~~~~~~~~~~   35 (69)
T cd01659           1 LVLFYAPWCPFCQALR-PVLAEL-AL--LNKGVKFEAVD   35 (69)
T ss_pred             CEEEECCCChhHHhhh-hHHHHH-Hh--hCCCcEEEEEE
Confidence            4578999999999884 334433 22  33444444443


No 49 
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]
Probab=47.67  E-value=12  Score=25.85  Aligned_cols=16  Identities=25%  Similarity=0.667  Sum_probs=14.7

Q ss_pred             EEEEEEEeCChhhHHH
Q 030664           43 KLGLYYESLCPYSANF   58 (173)
Q Consensus        43 ~V~vyyESlCPd~~~F   58 (173)
                      +|++|.-+-||+|.+-
T Consensus         2 ~v~iyt~~~CPyC~~a   17 (80)
T COG0695           2 NVTIYTKPGCPYCKRA   17 (80)
T ss_pred             CEEEEECCCCchHHHH
Confidence            5899999999999987


No 50 
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins. PRX-GRX hybrid proteins from Haemophilus influenza and Neisseria meningitis exhibit GSH-dependent peroxidase activity. The flow of reducing equivalents in the catalytic cycle of the hybrid protein goes from NADPH - GSH reductase - GSH - GRX domain of hybrid - PRX domain of hybrid - peroxide substrate.
Probab=47.35  E-value=15  Score=24.11  Aligned_cols=16  Identities=25%  Similarity=0.654  Sum_probs=14.8

Q ss_pred             EEEEEEEeCChhhHHH
Q 030664           43 KLGLYYESLCPYSANF   58 (173)
Q Consensus        43 ~V~vyyESlCPd~~~F   58 (173)
                      +|.+|.-+-||+|.+-
T Consensus         2 ~v~lys~~~Cp~C~~a   17 (72)
T cd03029           2 SVSLFTKPGCPFCARA   17 (72)
T ss_pred             eEEEEECCCCHHHHHH
Confidence            5899999999999987


No 51 
>PF11287 DUF3088:  Protein of unknown function (DUF3088);  InterPro: IPR021439  This family of proteins with unknown function appears to be restricted to Proteobacteria. 
Probab=47.12  E-value=10  Score=28.79  Aligned_cols=33  Identities=24%  Similarity=0.422  Sum_probs=26.1

Q ss_pred             CChhhHHHHHHhHHHHHhhccCCceeeEEEEEeeeee
Q 030664           51 LCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAK   87 (173)
Q Consensus        51 lCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~A~   87 (173)
                      .||+|...  +-|+-.+-.  +.+.+||+.|+|-+.+
T Consensus        23 ~Cp~c~~i--EGlLa~~P~--l~~~ldV~rV~f~RPR   55 (112)
T PF11287_consen   23 YCPHCAAI--EGLLASFPD--LRERLDVRRVDFPRPR   55 (112)
T ss_pred             ECCchHHH--HhHHhhChh--hhhcccEEEeCCCCch
Confidence            59999965  456666654  8899999999997766


No 52 
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold and has been shown to be localized to the periplasm. Unlike the related protein TrbB (TIGR02738), TraF does not contain a conserved pair of cysteines and has been shown not to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. Even more closely related than TrbB is a clade of genes (TIGR02740) which do contain the CXXC motif, but it is unclear whether these genes are involved in type-F conjugation systems per se.
Probab=46.99  E-value=15  Score=31.55  Aligned_cols=38  Identities=13%  Similarity=0.290  Sum_probs=29.0

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEee
Q 030664           40 SKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWG   84 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G   84 (173)
                      ++--+-++|++.||.|+.|     .|++..  +.+.-.++++|+-
T Consensus       150 ~~~gL~fFy~~~C~~C~~~-----apil~~--fa~~ygi~v~~VS  187 (256)
T TIGR02739       150 QSYGLFFFYRGKSPISQKM-----APVIQA--FAKEYGISVIPIS  187 (256)
T ss_pred             hceeEEEEECCCCchhHHH-----HHHHHH--HHHHhCCeEEEEe
Confidence            4567889999999999965     466654  6666778888873


No 53 
>TIGR02183 GRXA Glutaredoxin, GrxA family. This model includes the E. coli glyutaredoxin GrxA which appears to have primary responsibility for the reduction of ribonucleotide reductase.
Probab=46.43  E-value=13  Score=25.71  Aligned_cols=15  Identities=20%  Similarity=0.532  Sum_probs=14.0

Q ss_pred             EEEEEEeCChhhHHH
Q 030664           44 LGLYYESLCPYSANF   58 (173)
Q Consensus        44 V~vyyESlCPd~~~F   58 (173)
                      |+||.-+-||+|.+.
T Consensus         2 V~vys~~~Cp~C~~a   16 (86)
T TIGR02183         2 VVIFGRPGCPYCVRA   16 (86)
T ss_pred             EEEEeCCCCccHHHH
Confidence            789999999999987


No 54 
>TIGR01126 pdi_dom protein disulfide-isomerase domain. This model describes a domain of eukaryotic protein disulfide isomerases, generally found in two copies. The high cutoff for total score reflects the expectation of finding both copies. The domain is similar to thioredoxin but the redox-active disulfide region motif is APWCGHCK.
Probab=45.27  E-value=46  Score=22.41  Aligned_cols=21  Identities=24%  Similarity=0.371  Sum_probs=18.9

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q 030664           39 NSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      ..++-+-.||.+-||.|+++.
T Consensus        12 ~~~~~~i~f~~~~C~~c~~~~   32 (102)
T TIGR01126        12 SNKDVLVEFYAPWCGHCKNLA   32 (102)
T ss_pred             cCCcEEEEEECCCCHHHHhhC
Confidence            577889999999999999984


No 55 
>PRK10638 glutaredoxin 3; Provisional
Probab=44.55  E-value=21  Score=24.31  Aligned_cols=17  Identities=18%  Similarity=0.606  Sum_probs=15.1

Q ss_pred             EEEEEEEeCChhhHHHH
Q 030664           43 KLGLYYESLCPYSANFI   59 (173)
Q Consensus        43 ~V~vyyESlCPd~~~Fi   59 (173)
                      +|++|..+-||+|++..
T Consensus         3 ~v~ly~~~~Cp~C~~a~   19 (83)
T PRK10638          3 NVEIYTKATCPFCHRAK   19 (83)
T ss_pred             cEEEEECCCChhHHHHH
Confidence            58899999999999873


No 56 
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain. Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3.
Probab=43.78  E-value=68  Score=23.19  Aligned_cols=43  Identities=16%  Similarity=0.186  Sum_probs=30.6

Q ss_pred             CCCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEe
Q 030664           37 DVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPW   83 (173)
Q Consensus        37 ~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~   83 (173)
                      .-..|+-|-.++-+-||.|++.+ ..|..++++  +.+ -+++++..
T Consensus        20 ~~~gk~vvl~F~a~~C~~C~~~~-p~l~~l~~~--~~~-~~~~vi~i   62 (126)
T cd03012          20 QLRGKVVLLDFWTYCCINCLHTL-PYLTDLEQK--YKD-DGLVVIGV   62 (126)
T ss_pred             HhCCCEEEEEEECCCCccHHHHH-HHHHHHHHH--cCc-CCeEEEEe
Confidence            33567888888999999999986 457777775  654 24555543


No 57 
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit. This enzyme is the partner of the peroxiredoxin (alkyl hydroperoxide reductase) AhpC which contains the peroxide-reactive cysteine. AhpF contains the reductant (NAD(P)H) binding domain (pfam00070) and presumably acts to resolve the disulfide which forms after oxidation of the active site cysteine in AphC. This proteins contains two paired conserved cysteine motifs, CxxCP and CxHCDGP.
Probab=43.55  E-value=29  Score=31.96  Aligned_cols=46  Identities=7%  Similarity=0.109  Sum_probs=29.2

Q ss_pred             HHHHHHHHhccccCCCCCCCCC----CCCCCCeeEEEEEEEeCChhhHHHH
Q 030664           13 SLVFYITLFCFLSGSVSASRTS----PSDVNSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~----~~~~~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      +.+|++.|.-.+.+ .++....    ...-+.+++|++|+-.-||+|.+-+
T Consensus        87 f~s~i~~i~~~~~~-~~~l~~~~~~~~~~~~~~~~i~~f~~~~Cp~Cp~~v  136 (515)
T TIGR03140        87 FTSLVLAILQVGGH-GPKLDEGIIDRIRRLNGPLHFETYVSLTCQNCPDVV  136 (515)
T ss_pred             HHHHHHHHHHhcCC-CCCCCHHHHHHHHhcCCCeEEEEEEeCCCCCCHHHH
Confidence            34566665543333 2333221    3344678999999999999999753


No 58 
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants. Members of this family include PDI and PDI-related proteins like ERp72, ERp57 (or ERp60), ERp44, P5, PDIR, ERp46 and the transmembrane PDIs. PDI, ERp57, ERp72, P5, PDIR and ERp46 are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins usually contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and may also contain one or more redox inactive TRX-like (b) domains. Only one a domain is required for the oxidase function but multiple copies 
Probab=43.26  E-value=74  Score=20.85  Aligned_cols=26  Identities=15%  Similarity=0.176  Sum_probs=19.1

Q ss_pred             eEEEEEEEeCChhhHHHHHHhHHHHHh
Q 030664           42 VKLGLYYESLCPYSANFIINYLVKIFE   68 (173)
Q Consensus        42 V~V~vyyESlCPd~~~Fi~~qL~P~~~   68 (173)
                      .-|-.||.+-||.|+.+. ..+..+.+
T Consensus        17 ~~~v~f~~~~C~~C~~~~-~~~~~~~~   42 (101)
T cd02961          17 DVLVEFYAPWCGHCKALA-PEYEKLAK   42 (101)
T ss_pred             cEEEEEECCCCHHHHhhh-HHHHHHHH
Confidence            678888889999999984 34444444


No 59 
>PF13192 Thioredoxin_3:  Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B ....
Probab=42.18  E-value=88  Score=20.91  Aligned_cols=35  Identities=20%  Similarity=0.600  Sum_probs=21.9

Q ss_pred             eEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEE
Q 030664           42 VKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSP   82 (173)
Q Consensus        42 V~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP   82 (173)
                      ++|.+ +-+-||.|.+.. ..+..+...  . + ++++.+-
T Consensus         1 m~I~v-~~~~C~~C~~~~-~~~~~~~~~--~-~-i~~ei~~   35 (76)
T PF13192_consen    1 MKIKV-FSPGCPYCPELV-QLLKEAAEE--L-G-IEVEIID   35 (76)
T ss_dssp             EEEEE-ECSSCTTHHHHH-HHHHHHHHH--T-T-EEEEEEE
T ss_pred             CEEEE-eCCCCCCcHHHH-HHHHHHHHh--c-C-CeEEEEE
Confidence            57788 566699999663 344555554  4 3 6665544


No 60 
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO. They are proteins serving a critical role in the assembly of multimeric [NiFe] hydrogenases, the enzymes that catalyze the oxidation of molecular hydrogen to enable microorganisms to utilize hydrogen as the sole energy source. The E. coli HyaE protein is a chaperone that specifically interacts with the twin-arginine translocation (Tat) signal peptide of the [NiFe] hydrogenase-1 beta subunit precursor. Tat signal peptides target precursor proteins to the Tat protein export system, which facilitates the transport of fully folded proteins across the inner membrane. HyaE may be involved in regulating the traffic of [NiFe] hydrogenase-1 on the Tat transport pathway.
Probab=40.21  E-value=57  Score=24.40  Aligned_cols=36  Identities=6%  Similarity=-0.080  Sum_probs=20.7

Q ss_pred             CCCeeEEEEEEEe--CChhhHHHHHHhHHHHHhhccCCcee
Q 030664           38 VNSKVKLGLYYES--LCPYSANFIINYLVKIFEDVDLLSIV   76 (173)
Q Consensus        38 ~~~kV~V~vyyES--lCPd~~~Fi~~qL~P~~~~~~l~d~v   76 (173)
                      +.+.+.|-.||..  .||+|+.+  ...++-+.+ ++.+.+
T Consensus        25 ~~~~~~v~~f~~~~~~cp~c~~i--~P~leela~-e~~~~v   62 (111)
T cd02965          25 AAGGDLVLLLAGDPVRFPEVLDV--AVVLPELLK-AFPGRF   62 (111)
T ss_pred             hCCCCEEEEecCCcccCcchhhh--HhHHHHHHH-HCCCcE
Confidence            3444566666766  69999976  234443333 355543


No 61 
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative. This model describes a small family of proteins believed to aid in the export of various class II bacteriocins, which are ribosomally-synthesized, non-lantibiotic bacterial peptide antibiotics. Members of this family are found in operons for pediocin PA-1 from Pediococcus acidilactici and brochocin-C from Brochothrix campestris.
Probab=39.18  E-value=23  Score=26.34  Aligned_cols=19  Identities=21%  Similarity=0.441  Sum_probs=15.5

Q ss_pred             CeeEEEEEEEeCChhhHHH
Q 030664           40 SKVKLGLYYESLCPYSANF   58 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~F   58 (173)
                      .+.-|-.|+-+-||+|+.|
T Consensus        23 ~~~~iv~f~~~~Cp~C~~~   41 (122)
T TIGR01295        23 KETATFFIGRKTCPYCRKF   41 (122)
T ss_pred             CCcEEEEEECCCChhHHHH
Confidence            4445777899999999988


No 62 
>PRK09381 trxA thioredoxin; Provisional
Probab=38.61  E-value=97  Score=21.58  Aligned_cols=30  Identities=13%  Similarity=0.166  Sum_probs=20.5

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhHHHHHhh
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYLVKIFED   69 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~   69 (173)
                      .++.-|-.+|-+-||.|+.+. ..+..+.+.
T Consensus        20 ~~~~vvv~f~~~~C~~C~~~~-p~~~~l~~~   49 (109)
T PRK09381         20 ADGAILVDFWAEWCGPCKMIA-PILDEIADE   49 (109)
T ss_pred             CCCeEEEEEECCCCHHHHHHh-HHHHHHHHH
Confidence            355667888889999999884 334444443


No 63 
>PRK10329 glutaredoxin-like protein; Provisional
Probab=37.80  E-value=26  Score=24.21  Aligned_cols=20  Identities=10%  Similarity=0.235  Sum_probs=16.2

Q ss_pred             EEEEEEEeCChhhHHHHHHhH
Q 030664           43 KLGLYYESLCPYSANFIINYL   63 (173)
Q Consensus        43 ~V~vyyESlCPd~~~Fi~~qL   63 (173)
                      +|++|.-+-||+|.+- +..|
T Consensus         2 ~v~lYt~~~Cp~C~~a-k~~L   21 (81)
T PRK10329          2 RITIYTRNDCVQCHAT-KRAM   21 (81)
T ss_pred             EEEEEeCCCCHhHHHH-HHHH
Confidence            5889999999999984 4444


No 64 
>TIGR01068 thioredoxin thioredoxin. Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by this model.
Probab=37.31  E-value=82  Score=20.95  Aligned_cols=27  Identities=15%  Similarity=0.156  Sum_probs=19.1

Q ss_pred             CeeEEEEEEEeCChhhHHHHHHhHHHHH
Q 030664           40 SKVKLGLYYESLCPYSANFIINYLVKIF   67 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi~~qL~P~~   67 (173)
                      ++.-|-.+|..-||.|+.+. ..+..+.
T Consensus        14 ~~~vvi~f~~~~C~~C~~~~-~~l~~~~   40 (101)
T TIGR01068        14 DKPVLVDFWAPWCGPCKMIA-PILEELA   40 (101)
T ss_pred             CCcEEEEEECCCCHHHHHhC-HHHHHHH
Confidence            45667788899999999884 3344333


No 65 
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain). Like PDI, P5 is located in the endoplasmic reticulum (ER) and displays both isomerase and chaperone activities, which are independent of each other. Compared to PDI, the isomerase and chaperone activities of P5 are lower. The first cysteine in the CXXC motif of both redox active domains in P5 is necessary for isomerase activity. The P5 gene was first isolated as an amplified gene from a hydroxyurea-resistant hamster cell line. The zebrafish P5 homolog has been implicated to play a critical role in establishing left/right asymmetries in the embryonic midline. Some members of this subfamily are P5-like proteins containing only one redox active TRX domain.
Probab=36.98  E-value=1e+02  Score=20.88  Aligned_cols=20  Identities=25%  Similarity=0.398  Sum_probs=15.5

Q ss_pred             CeeEEEEEEEeCChhhHHHH
Q 030664           40 SKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi   59 (173)
                      ++.-+-.+|-+-||.|+++.
T Consensus        18 ~~~vlv~f~a~~C~~C~~~~   37 (103)
T cd03001          18 DDVWLVEFYAPWCGHCKNLA   37 (103)
T ss_pred             CCcEEEEEECCCCHHHHHHh
Confidence            44456677788999999984


No 66 
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus. It is found only in oxygenic photosynthetic organisms. TRX is a small enzyme that participate in redox reactions, via the reversible oxidation of an active site dithiol present in a CXXC motif. Disruption of the txlA gene suggests that the protein is involved in the redox regulation  of the structure and function of photosynthetic apparatus. The plant homolog (designated as HCF164) is localized in the chloroplast and is involved in the assembly of the cytochrome b6f complex, which takes a central position in photosynthetic electron transport.
Probab=36.93  E-value=87  Score=23.73  Aligned_cols=22  Identities=23%  Similarity=0.416  Sum_probs=17.8

Q ss_pred             CCCeeEEEEEEEeCChhhHHHH
Q 030664           38 VNSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        38 ~~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      ..+++-|-.||-+-||.|+.+.
T Consensus        18 ~~gk~vvV~F~A~WC~~C~~~~   39 (142)
T cd02950          18 SNGKPTLVEFYADWCTVCQEMA   39 (142)
T ss_pred             hCCCEEEEEEECCcCHHHHHhH
Confidence            4567777788899999999874


No 67 
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein. MPD1 has been shown to suppress the maturation defect of carboxypeptidase Y caused by deletion of the yeast PDI1 gene. Other characterized members of this subfamily include the Aspergillus niger prpA protein and Giardia PDI-1. PrpA is non-essential to strain viability, however, its transcript level is induced by heterologous protein expression suggesting a possible role in oxidative protein folding during high protein production. Giardia PDI-1 has the ability to refold scrambled RNase and exhibits transglutaminase activity.
Probab=36.17  E-value=84  Score=21.68  Aligned_cols=21  Identities=19%  Similarity=0.335  Sum_probs=16.9

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q 030664           39 NSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      .++.-|-.||-+-||.|+++.
T Consensus        17 ~~~~~lv~f~a~wC~~C~~~~   37 (109)
T cd03002          17 TNYTTLVEFYAPWCGHCKNLK   37 (109)
T ss_pred             CCCeEEEEEECCCCHHHHhhC
Confidence            356677888889999999874


No 68 
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-redoxin is a representative of a class of small redox proteins that contain a conserved CXXC motif and are characterized by a glutaredoxin-like amino acid sequence and thioredoxin-like activity profile. Unlike other the glutaredoxins to which it is most closely related, NrdH aparrently does not interact with glutathione/glutathione reductase, but rather with thioredoxin reductase to catalyze the reduction of ribonucleotide reductase.
Probab=36.01  E-value=21  Score=23.54  Aligned_cols=15  Identities=13%  Similarity=0.264  Sum_probs=13.4

Q ss_pred             EEEEEEeCChhhHHH
Q 030664           44 LGLYYESLCPYSANF   58 (173)
Q Consensus        44 V~vyyESlCPd~~~F   58 (173)
                      |+||.-.-||+|++-
T Consensus         1 v~ly~~~~Cp~C~~a   15 (72)
T TIGR02194         1 ITVYSKNNCVQCKMT   15 (72)
T ss_pred             CEEEeCCCCHHHHHH
Confidence            579999999999976


No 69 
>PTZ00051 thioredoxin; Provisional
Probab=35.72  E-value=1.1e+02  Score=20.60  Aligned_cols=29  Identities=7%  Similarity=0.216  Sum_probs=20.6

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhHHHHHh
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYLVKIFE   68 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~   68 (173)
                      ..++-|-.||-+-||.|+.+. ..|..+.+
T Consensus        17 ~~~~vli~f~~~~C~~C~~~~-~~l~~l~~   45 (98)
T PTZ00051         17 QNELVIVDFYAEWCGPCKRIA-PFYEECSK   45 (98)
T ss_pred             cCCeEEEEEECCCCHHHHHHh-HHHHHHHH
Confidence            356778888999999999984 34444333


No 70 
>COG2761 FrnE Predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=34.05  E-value=78  Score=26.75  Aligned_cols=119  Identities=13%  Similarity=0.113  Sum_probs=68.9

Q ss_pred             CCCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEE--EEEeeeeeeecCCCceeecC------------C---
Q 030664           38 VNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLH--LSPWGNAKIRANNSTFDCQH------------G---  100 (173)
Q Consensus        38 ~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~--lvP~G~A~~~~~~~~f~CQH------------G---  100 (173)
                      ...+++|+||..=.||.|--. ...|-.+...  +.+.++++  ..||=-.-.       -|+|            |   
T Consensus         2 ~~~~i~I~v~sD~vCPwC~ig-~~rL~ka~~~--~~~~~~v~i~w~pf~l~p~-------~~~~g~~~~~~l~~k~g~~~   71 (225)
T COG2761           2 NPMKIEIDVFSDVVCPWCYIG-KRRLEKALAE--YPQEVRVEIRWRPFELDPD-------LPPEGLDRKEYLAQKYGISE   71 (225)
T ss_pred             CCceEEEEEEeCCcCchhhcC-HHHHHHHHHh--cCcceeEEEEecccccCCC-------CCcccccHHHHHHHHhCccH
Confidence            356899999999999999754 4556666664  66555544  445532110       1121            1   


Q ss_pred             ------------hhh-----------hhcChhhhhhhcccc-ccc-cccceeeccccccc-----ccccchHHhHHhhcC
Q 030664          101 ------------PSE-----------CLLNTVEACAIDSWP-ELN-KHFPFIYCIESLVY-----EHKYSQWETCFDKLE  150 (173)
Q Consensus       101 ------------~~E-----------C~gN~~qaCai~~~~-~~~-~~l~fI~Cm~~~~~-----~~~~~~~~~Ca~~~g  150 (173)
                                  -.|           =..|.+.+|-+.++- .+. .+..|+.=+.+..+     .++.+..-.||.++|
T Consensus        72 ~~~~~~~~~~~~~~~~Gi~~~f~~~~~~~nt~~Ah~l~~~A~~~G~~~~~~~~~lf~AyF~eg~nI~D~dVL~diA~~~G  151 (225)
T COG2761          72 EQKAAHARLEELAEEEGIDFNFDAIVPAPNTLDAHRLIKAAELQGKAQDRFLEALFEAYFEEGRNIGDEDVLADIAEEVG  151 (225)
T ss_pred             HHHHHHHHHHHhhHhcCcccchhhccCCCchHHHHHHHHHHHHhCchHHHHHHHHHHHHhccCCCCCcHHHHHHHHHHhC
Confidence                        111           122345555444431 122 46677666655443     233455679999999


Q ss_pred             CCchhhhcccCCchhh
Q 030664          151 LDPKPIVDCYTSGYGT  166 (173)
Q Consensus       151 ld~~~I~~C~~~~~G~  166 (173)
                      +|.+.+.+=..++..+
T Consensus       152 LD~~~~~~~L~s~~~~  167 (225)
T COG2761         152 LDREEFKADLASDAAK  167 (225)
T ss_pred             CCHHHHHHHHhChHHH
Confidence            9988777665555443


No 71 
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2. Unlike cytosolic PGE synthase (cPGES) and microsomal PGES Type 1 (mPGES1), mPGES2 does not require glutathione (GSH) for its activity, although its catalytic rate is increased two- to four-fold in the presence of DTT, GSH or other thiol compounds. PGE2 is widely distributed in various tissues and is implicated in the sleep/wake cycle, relaxation/contraction of smooth muscle, excretion of sodium ions, maintenance of body temperature and mediation of inflammation. mPGES2 contains an N-terminal hydrophobic domain which is membrane associated, and a C-terminal soluble domain with a GST-like structure.
Probab=33.92  E-value=30  Score=22.75  Aligned_cols=17  Identities=29%  Similarity=0.675  Sum_probs=14.8

Q ss_pred             EEEEEEEeCChhhHHHH
Q 030664           43 KLGLYYESLCPYSANFI   59 (173)
Q Consensus        43 ~V~vyyESlCPd~~~Fi   59 (173)
                      ++++|+-..||.|++-.
T Consensus         1 ~i~Ly~~~~~p~c~kv~   17 (77)
T cd03040           1 KITLYQYKTCPFCCKVR   17 (77)
T ss_pred             CEEEEEcCCCHHHHHHH
Confidence            47899999999999874


No 72 
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5. The cDNA clone of this protein (named G1) was isolated from an alfalfa cDNA library by screening with human protein disulfide isomerase (PDI) cDNA. The G1 protein is constitutively expressed in all major organs of the plant and its expression is induced by treatment with tunicamycin, indicating that it may be a glucose-regulated protein. The G1 homolog in the eukaryotic social amoeba Dictyostelium discoideum is also described as a P5-like protein, which is located in the endoplasmic reticulum (ER) despite the absence of an ER-retrieval signal. G1 homologs from Aspergillus niger and Neurospora crassa have also been characterized, and are named TIGA and ER
Probab=33.20  E-value=91  Score=21.02  Aligned_cols=21  Identities=24%  Similarity=0.379  Sum_probs=17.0

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q 030664           39 NSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      ..+.-|-.||-+-||.|+++.
T Consensus        17 ~~~~~~v~f~a~~C~~C~~~~   37 (105)
T cd02998          17 DKKDVLVEFYAPWCGHCKNLA   37 (105)
T ss_pred             CCCcEEEEEECCCCHHHHhhC
Confidence            345678888899999999883


No 73 
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as  JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is composed of the three TRX domains located at the C-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation. Also included in the alignment is the single complete TRX domain of an uncharacterized protein from Tetraodon nigroviridis, which also contains a DnaJ domain at its N-terminus.
Probab=31.05  E-value=1.6e+02  Score=20.17  Aligned_cols=21  Identities=14%  Similarity=0.268  Sum_probs=16.6

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q 030664           39 NSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      .+++-|-.||-+-||.|+++.
T Consensus        18 ~~~~v~v~f~a~wC~~C~~~~   38 (104)
T cd03004          18 RKEPWLVDFYAPWCGPCQALL   38 (104)
T ss_pred             CCCeEEEEEECCCCHHHHHHH
Confidence            344667788899999999873


No 74 
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]
Probab=31.04  E-value=36  Score=25.17  Aligned_cols=39  Identities=21%  Similarity=0.338  Sum_probs=25.5

Q ss_pred             EEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeee
Q 030664           43 KLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGN   85 (173)
Q Consensus        43 ~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~   85 (173)
                      +|-+|--|.||+|.+ +.+.|.- +.-  -...++|.-.|-|.
T Consensus        15 ~VVifSKs~C~~c~~-~k~ll~~-~~v--~~~vvELD~~~~g~   53 (104)
T KOG1752|consen   15 PVVIFSKSSCPYCHR-AKELLSD-LGV--NPKVVELDEDEDGS   53 (104)
T ss_pred             CEEEEECCcCchHHH-HHHHHHh-CCC--CCEEEEccCCCCcH
Confidence            678999999999999 4544433 321  33566666665554


No 75 
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB. This protein is part of a large group of proteins involved in conjugative transfer of plasmid DNA, specifically the F-type system. This protein has been predicted to contain a thioredoxin fold, contains a conserved pair of cysteines and has been shown to function as a thiol disulfide isomerase by complementation of an Ecoli DsbA defect. The protein is believed to be involved in pilin assembly. The protein is closely related to TraF (TIGR02739) which is somewhat longer, lacks the cysteine motif and is apparently not functional as a disulfide bond isomerase.
Probab=30.98  E-value=65  Score=25.10  Aligned_cols=20  Identities=35%  Similarity=0.846  Sum_probs=16.5

Q ss_pred             CeeEEEEEEEeCChhhHHHH
Q 030664           40 SKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi   59 (173)
                      .+..|-.||-|-||.|++.+
T Consensus        50 ~~~~lvnFWAsWCppCr~e~   69 (153)
T TIGR02738        50 DDYALVFFYQSTCPYCHQFA   69 (153)
T ss_pred             CCCEEEEEECCCChhHHHHH
Confidence            34458889999999999885


No 76 
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a conserved cysteine that aligns to the first cysteine in the CXXC motif of TRX. This does not correspond to the peroxidatic cysteine found in PRXs, which aligns to the second cysteine in the CXXC motif of TRX. In addition, these proteins do not contain the other two conserved residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF.
Probab=30.86  E-value=1.1e+02  Score=23.33  Aligned_cols=41  Identities=12%  Similarity=0.276  Sum_probs=28.4

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEe
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPW   83 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~   83 (173)
                      ..++.|-.++-+-||.|++-+ ..|..+.++  +++ -+++++-+
T Consensus        24 ~~k~~ll~f~~t~Cp~c~~~~-~~l~~l~~~--~~~-~~v~~v~i   64 (171)
T cd02969          24 DGKALVVMFICNHCPYVKAIE-DRLNRLAKE--YGA-KGVAVVAI   64 (171)
T ss_pred             CCCEEEEEEECCCCccHHHHH-HHHHHHHHH--Hhh-CCeEEEEE
Confidence            678888899999999998774 467766654  543 23444443


No 77 
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases. APS reductase catalyzes the reduction of activated sulfate to sulfite, a key step in the biosynthesis of sulfur-containing metabolites. Sulfate is first activated by ATP sulfurylase, forming APS, which can be phosphorylated to 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Depending on the organism, either APS or PAPS can be used for sulfate reduction. Prokaryotes and fungi use PAPS, whereas plants use both APS and PAPS. Since plant-type APS reductase uses glutathione (GSH) as its electron donor, the C-terminal domain may function like glutaredoxin, a GSH-dependent member of the TRX superfamily. The flow of reducing equivalents goes from GSH - C-terminal TRX domain - N-terminal reductase domain - APS. Plant-type APS red
Probab=30.77  E-value=1.3e+02  Score=21.24  Aligned_cols=22  Identities=18%  Similarity=0.493  Sum_probs=17.9

Q ss_pred             CCCeeEEEEEEEeCChhhHHHH
Q 030664           38 VNSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        38 ~~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      ..+++-+-.||-+-||.|+++.
T Consensus        19 ~~~k~vlv~f~a~wC~~C~~~~   40 (109)
T cd02993          19 RRNQSTLVVLYAPWCPFCQAME   40 (109)
T ss_pred             hcCCCEEEEEECCCCHHHHHHh
Confidence            3457788889999999999873


No 78 
>PF15299 ALS2CR8:  Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8
Probab=30.52  E-value=15  Score=30.46  Aligned_cols=25  Identities=20%  Similarity=0.480  Sum_probs=17.3

Q ss_pred             ceeeEEEEEeeeeeeecCCCceeecCChh
Q 030664           74 SIVDLHLSPWGNAKIRANNSTFDCQHGPS  102 (173)
Q Consensus        74 d~vdl~lvP~G~A~~~~~~~~f~CQHG~~  102 (173)
                      -+|.+.-|||=    -.+...+.||||+.
T Consensus        20 ~~ip~dgiPFi----~~g~~~~~Cq~G~d   44 (225)
T PF15299_consen   20 VYIPFDGIPFI----IIGTKVYECQHGKD   44 (225)
T ss_pred             ccccCCCCCeE----EeeceEEEeeCCCc
Confidence            35667777774    22346788999995


No 79 
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain. Its gene has been sequenced from several gammaproteobacteria and actinobacteria.
Probab=30.39  E-value=1.3e+02  Score=20.22  Aligned_cols=22  Identities=9%  Similarity=0.131  Sum_probs=17.6

Q ss_pred             CCCeeEEEEEEEeCChhhHHHH
Q 030664           38 VNSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        38 ~~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      +..++-|-.+|-+-||.|+.+.
T Consensus        10 ~~~~~vlv~f~a~wC~~C~~~~   31 (96)
T cd02956          10 STQVPVVVDFWAPRSPPSKELL   31 (96)
T ss_pred             cCCCeEEEEEECCCChHHHHHH
Confidence            3456778888999999999773


No 80 
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]
Probab=29.65  E-value=33  Score=24.55  Aligned_cols=19  Identities=37%  Similarity=0.677  Sum_probs=15.2

Q ss_pred             EEEEEeCChhhHHHHHHhHH
Q 030664           45 GLYYESLCPYSANFIINYLV   64 (173)
Q Consensus        45 ~vyyESlCPd~~~Fi~~qL~   64 (173)
                      .+|+--+||||.-|+ +.|-
T Consensus         5 ~lfgsn~Cpdca~a~-eyl~   23 (85)
T COG4545           5 KLFGSNLCPDCAPAV-EYLE   23 (85)
T ss_pred             eeeccccCcchHHHH-HHHH
Confidence            689999999999995 3443


No 81 
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library. It contains a TRX domain but the redox active CXXC motif is replaced with SXXC. Sequence analysis predicts that TMX2 may be a Type I membrane protein, with its C-terminal half protruding on the luminal side of the endoplasmic reticulum (ER). In addition to the TRX domain, transmembrane region and ER-retention signal, TMX2 also contains a Myb DNA-binding domain repeat signature and a dileucine motif in the tail.
Probab=29.21  E-value=1.2e+02  Score=23.58  Aligned_cols=19  Identities=21%  Similarity=0.342  Sum_probs=15.7

Q ss_pred             CeeEEEEEEEeCChhhHHH
Q 030664           40 SKVKLGLYYESLCPYSANF   58 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~F   58 (173)
                      .++-|-.||-+-||.|+.+
T Consensus        47 ~~~vvV~Fya~wC~~Ck~l   65 (152)
T cd02962          47 RVTWLVEFFTTWSPECVNF   65 (152)
T ss_pred             CCEEEEEEECCCCHHHHHH
Confidence            4566888899999999966


No 82 
>PF06110 DUF953:  Eukaryotic protein of unknown function (DUF953);  InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like.; PDB: 1V9W_A 1WOU_A.
Probab=28.94  E-value=1.1e+02  Score=23.13  Aligned_cols=20  Identities=25%  Similarity=0.391  Sum_probs=12.4

Q ss_pred             EeCChhhHHHHHHhHHHHHhh
Q 030664           49 ESLCPYSANFIINYLVKIFED   69 (173)
Q Consensus        49 ESlCPd~~~Fi~~qL~P~~~~   69 (173)
                      .|=||||++- .-.+..++..
T Consensus        35 ~sWCPDC~~a-ep~v~~~f~~   54 (119)
T PF06110_consen   35 QSWCPDCVAA-EPVVEKAFKK   54 (119)
T ss_dssp             -BSSHHHHHH-HHHHHHHHHH
T ss_pred             CcccHHHHHH-HHHHHHHHHh
Confidence            3569999987 3344555554


No 83 
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD. It contains a CXXC motif in a TRX fold and shuttles the reducing potential from the membrane domain (DsbD beta) to the N-terminal periplasmic domain (DsbD alpha).  DsbD beta, a transmembrane domain comprising of eight helices, acquires its reducing potential from the cytoplasmic thioredoxin. DsbD alpha transfers the acquired reducing potential from DsbD gamma to target proteins such as the periplasmic protein disulphide isomerases, DsbC and DsbG. This flow of reducing potential from the cytoplasm through DsbD allows DsbC and DsbG to act as isomerases in the oxidizing environment of the bacterial periplasm. DsbD also transfers reducing potential from the cytoplasm to specific reductases in the periplasm which are involved in the maturation of cytochromes.
Probab=28.59  E-value=73  Score=22.08  Aligned_cols=21  Identities=10%  Similarity=-0.029  Sum_probs=16.6

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q 030664           39 NSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      .+++-+-.||-+-||.|+++.
T Consensus        10 ~~k~vlv~f~a~wC~~C~~~~   30 (104)
T cd02953          10 QGKPVFVDFTADWCVTCKVNE   30 (104)
T ss_pred             cCCeEEEEEEcchhHHHHHHH
Confidence            345666688889999999985


No 84 
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding. PfPDO contains two redox active CXXC motifs in two contiguous TRX-fold subdomains. The active site in the N-terminal TRX-fold subdomain is required for isomerase but not for reductase activity of PfPDO. The exclusive presence of PfPDO-like proteins in extremophiles may suggest that they have a special role in adaptation to extreme conditions.
Probab=27.94  E-value=1.3e+02  Score=21.78  Aligned_cols=19  Identities=21%  Similarity=0.382  Sum_probs=13.8

Q ss_pred             CeeEEEEE-EEeCChhhHHH
Q 030664           40 SKVKLGLY-YESLCPYSANF   58 (173)
Q Consensus        40 ~kV~V~vy-yESlCPd~~~F   58 (173)
                      .++.|.|+ +-+-||.|+.+
T Consensus        21 ~~~~vvv~f~a~wC~~C~~~   40 (113)
T cd02975          21 NPVDLVVFSSKEGCQYCEVT   40 (113)
T ss_pred             CCeEEEEEeCCCCCCChHHH
Confidence            35566666 56799999865


No 85 
>PRK10996 thioredoxin 2; Provisional
Probab=27.92  E-value=1.3e+02  Score=22.50  Aligned_cols=30  Identities=10%  Similarity=0.184  Sum_probs=22.1

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhHHHHHhh
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYLVKIFED   69 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~   69 (173)
                      .+++-|-.||-+-||.|+.+.. .+..+.+.
T Consensus        51 ~~k~vvv~F~a~wC~~C~~~~~-~l~~l~~~   80 (139)
T PRK10996         51 DDLPVVIDFWAPWCGPCRNFAP-IFEDVAAE   80 (139)
T ss_pred             CCCeEEEEEECCCCHHHHHHHH-HHHHHHHH
Confidence            3677788999999999999853 45555443


No 86 
>PRK03147 thiol-disulfide oxidoreductase; Provisional
Probab=27.85  E-value=2.4e+02  Score=21.12  Aligned_cols=30  Identities=10%  Similarity=0.302  Sum_probs=22.1

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhHHHHHhh
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYLVKIFED   69 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~   69 (173)
                      .+|+-+-.+|-+-||.|++.+ ..|..+.+.
T Consensus        60 ~~k~~~l~f~a~~C~~C~~~~-~~l~~~~~~   89 (173)
T PRK03147         60 KGKGVFLNFWGTWCKPCEKEM-PYMNELYPK   89 (173)
T ss_pred             CCCEEEEEEECCcCHHHHHHH-HHHHHHHHH
Confidence            456677788899999999875 456666654


No 87 
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related). PDIR is composed of three redox active TRX (a) domains and an N-terminal redox inactive TRX-like (b) domain. Similar to PDI, it is involved in oxidative protein folding in the endoplasmic reticulum (ER) through its isomerase and chaperone activities. These activities are lower compared to PDI, probably due to PDIR acting only on a subset of proteins. PDIR is preferentially expressed in cells actively secreting proteins and its expression is induced by stress. Similar to PDI, the isomerase and chaperone activities of PDIR are independent; CXXC mutants lacking isomerase activity retain chaperone activity.
Probab=27.33  E-value=1e+02  Score=20.83  Aligned_cols=20  Identities=20%  Similarity=0.393  Sum_probs=16.2

Q ss_pred             CeeEEEEEEEeCChhhHHHH
Q 030664           40 SKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi   59 (173)
                      .+.-+-.||-+-||.|+.+.
T Consensus        17 ~~~~~v~f~a~wC~~C~~~~   36 (104)
T cd02997          17 EKHVLVMFYAPWCGHCKKMK   36 (104)
T ss_pred             CCCEEEEEECCCCHHHHHhC
Confidence            34567888899999999984


No 88 
>PTZ00443 Thioredoxin domain-containing protein; Provisional
Probab=27.30  E-value=2.9e+02  Score=22.93  Aligned_cols=20  Identities=10%  Similarity=0.253  Sum_probs=16.1

Q ss_pred             CeeEEEEEEEeCChhhHHHH
Q 030664           40 SKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi   59 (173)
                      .++-+-.||-+-||.|+++.
T Consensus        52 ~~~vlV~FyApWC~~Ck~~~   71 (224)
T PTZ00443         52 TGPWFVKFYAPWCSHCRKMA   71 (224)
T ss_pred             CCCEEEEEECCCChHHHHHH
Confidence            35567778999999999874


No 89 
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is comprised of the first TRX domain of ERdj5 located after the DnaJ domain at the N-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation.
Probab=27.27  E-value=2.1e+02  Score=19.56  Aligned_cols=19  Identities=11%  Similarity=0.377  Sum_probs=15.9

Q ss_pred             CeeEEEEEEEeCChhhHHH
Q 030664           40 SKVKLGLYYESLCPYSANF   58 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~F   58 (173)
                      .++-+-.+|-.-||.|+.+
T Consensus        18 ~~~~~v~f~a~wC~~C~~~   36 (101)
T cd03003          18 GEIWFVNFYSPRCSHCHDL   36 (101)
T ss_pred             CCeEEEEEECCCChHHHHh
Confidence            3677888899999999976


No 90 
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif. Assembly of cytochrome c requires the ligation of heme to reduced thiols of the apocytochrome. In bacteria, this assembly occurs in the periplasm. The reductase activity of DsbE in the oxidizing environment of the periplasm is crucial in the maturation of cytochrome c.
Probab=26.89  E-value=54  Score=23.56  Aligned_cols=27  Identities=19%  Similarity=0.133  Sum_probs=19.7

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhHHHH
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYLVKI   66 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~   66 (173)
                      ..|+-|-.|+-+-||.|+..+ ..|...
T Consensus        24 ~gk~vvv~F~a~~C~~C~~~~-~~l~~l   50 (127)
T cd03010          24 KGKPYLLNVWASWCAPCREEH-PVLMAL   50 (127)
T ss_pred             CCCEEEEEEEcCcCHHHHHHH-HHHHHH
Confidence            456778888899999999875 334443


No 91 
>cd03022 DsbA_HCCA_Iso DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway. It converts HCCA, a hemiketal formed spontaneously after ring cleavage of 1,2-dihydroxynapthalene by a dioxygenase, into cis-o-hydroxybenzylidenepyruvate (cHBPA). This is the fourth reaction in a six-step pathway that converts napthalene into salicylate. HCCA isomerase is unique to bacteria that degrade polycyclic aromatic compounds. It is closely related to the eukaryotic protein, GSH transferase kappa (GSTK).
Probab=26.88  E-value=1.2e+02  Score=23.25  Aligned_cols=32  Identities=9%  Similarity=-0.022  Sum_probs=25.9

Q ss_pred             chHHhHHhhcCCCchhhhcccCCchhhHHHHh
Q 030664          140 SQWETCFDKLELDPKPIVDCYTSGYGTQVSLA  171 (173)
Q Consensus       140 ~~~~~Ca~~~gld~~~I~~C~~~~~G~~Ll~~  171 (173)
                      +....++++.|+|.+.+.++.++++.++.+.+
T Consensus       124 ~~l~~~a~~~Gld~~~~~~~~~~~~~~~~l~~  155 (192)
T cd03022         124 AVLAAVAAAAGLDADELLAAADDPAVKAALRA  155 (192)
T ss_pred             HHHHHHHHHcCCCHHHHHHHcCCHHHHHHHHH
Confidence            34668999999999999999998887665554


No 92 
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source. mauD is an essential accessory protein for the biosynthesis of methylamine dehydrogenase (MADH), the enzyme that catalyzes the oxidation of methylamine and other primary amines. MADH possesses an alpha2beta2 subunit structure; the alpha subunit is also referred to as the large subunit. Each beta (small) subunit contains a tryptophan tryptophylquinone (TTQ) prosthetic group. Accessory proteins are essential for the proper transport of MADH to the periplasm, TTQ synthesis and the formation of several structural disulfide bonds. Bacterial mutants containing an insertion on the mauD gene were unable to grow on methylamine as a sole carbon source, were found to lack the MADH small subunit and had decreased amounts of the MADH large subunit.
Probab=26.82  E-value=1.9e+02  Score=19.97  Aligned_cols=20  Identities=15%  Similarity=0.512  Sum_probs=16.5

Q ss_pred             CeeEEEEEEEeCChhhHHHH
Q 030664           40 SKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi   59 (173)
                      .|+-|-.||-+-||.|+..+
T Consensus        21 gk~vvl~F~~~wC~~C~~~~   40 (114)
T cd02967          21 GRPTLLFFLSPTCPVCKKLL   40 (114)
T ss_pred             CCeEEEEEECCCCcchHhHh
Confidence            56667778899999999875


No 93 
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family. This model represents a portion of the proteins within the larger set covered by Pfam model pfam03960. That larger family includes a glutaredoxin-dependent arsenate reductase (TIGR00014). Characterized members of this family include Spx and MgsR from Bacillus subtili. Spx is a global regulator for response to thiol-specific oxidative stress. It interacts with RNA polymerase. MgsR (modulator of the general stress response, also called YqgZ) provides a second level of regulation for more than a third of the proteins in the B. subtilis general stress regulon controlled by Sigma-B.
Probab=26.77  E-value=46  Score=24.35  Aligned_cols=16  Identities=13%  Similarity=0.218  Sum_probs=14.2

Q ss_pred             EEEEEEeCChhhHHHH
Q 030664           44 LGLYYESLCPYSANFI   59 (173)
Q Consensus        44 V~vyyESlCPd~~~Fi   59 (173)
                      |++|+-.-||.|++-.
T Consensus         1 i~iY~~~~C~~c~ka~   16 (117)
T TIGR01617         1 IKVYGSPNCTTCKKAR   16 (117)
T ss_pred             CEEEeCCCCHHHHHHH
Confidence            5799999999999875


No 94 
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain, similar to that of PDIa, with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. The CXFS motif in the N-terminal domain allows ERp44 to form stable reversible mixed disulfides with its substrates. Through this activity, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. It also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol.
Probab=26.62  E-value=2.2e+02  Score=19.71  Aligned_cols=20  Identities=20%  Similarity=0.469  Sum_probs=16.3

Q ss_pred             CeeEEEEEEEeCChhhHHHH
Q 030664           40 SKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        40 ~kV~V~vyyESlCPd~~~Fi   59 (173)
                      .+.-+-.||-+-||.|+++.
T Consensus        18 ~~~vlv~F~a~wC~~C~~~~   37 (108)
T cd02996          18 AELVLVNFYADWCRFSQMLH   37 (108)
T ss_pred             CCEEEEEEECCCCHHHHhhH
Confidence            35567888999999999874


No 95 
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein. This family of archaeal proteins contains a C-terminal domain with homology to bacterial and eukaryotic glutaredoxins, including a CPYC motif. There is an N-terminal domain which has even more distant homology to glutaredoxins. The name "glutaredoxin" may be inappropriate in the sense of working in tandem with glutathione and glutathione reductase which may not be present in the archaea. The overall domain structure appears to be related to bacterial alkylhydroperoxide reductases, but the homology may be distant enough that the function of this family is wholly different.
Probab=26.49  E-value=1.3e+02  Score=24.30  Aligned_cols=22  Identities=18%  Similarity=0.615  Sum_probs=18.9

Q ss_pred             CCCCeeEEEEEEEeCChhhHHH
Q 030664           37 DVNSKVKLGLYYESLCPYSANF   58 (173)
Q Consensus        37 ~~~~kV~V~vyyESlCPd~~~F   58 (173)
                      ....+|.|.+||-+-||.|+..
T Consensus       130 ~~~~pv~I~~F~a~~C~~C~~~  151 (215)
T TIGR02187       130 SLDEPVRIEVFVTPTCPYCPYA  151 (215)
T ss_pred             hcCCCcEEEEEECCCCCCcHHH
Confidence            3477899999999999999965


No 96 
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors. RdCVF was isolated and identified as a factor that supports cone survival in retinal cultures. Cone photoreceptor loss is responsible for the visual handicap resulting from the inherited disease, retinitis pigmentosa. RdCVF shows 33% similarity to TRX but does not exhibit any detectable thiol oxidoreductase activity.
Probab=26.29  E-value=1.2e+02  Score=23.60  Aligned_cols=31  Identities=19%  Similarity=0.261  Sum_probs=22.9

Q ss_pred             CCCCeeEEEEEEEeCChhhHHHHHHhHHHHHh
Q 030664           37 DVNSKVKLGLYYESLCPYSANFIINYLVKIFE   68 (173)
Q Consensus        37 ~~~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~   68 (173)
                      .-..|+-+--|+=|-||.|++++- .|..+++
T Consensus        22 ~~kgk~vlL~FwAsWCppCr~e~P-~L~~ly~   52 (146)
T cd03008          22 RLENRVLLLFFGAVVSPQCQLFAP-KLKDFFV   52 (146)
T ss_pred             HhCCCEEEEEEECCCChhHHHHHH-HHHHHHH
Confidence            445688888888999999999963 3545444


No 97 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=25.14  E-value=44  Score=25.15  Aligned_cols=17  Identities=18%  Similarity=0.286  Sum_probs=7.8

Q ss_pred             chhHHHHHHHHHHHhcc
Q 030664            7 SSTKALSLVFYITLFCF   23 (173)
Q Consensus         7 ~~~~~~~~~~~~~~~~~   23 (173)
                      +-+++|.++|+|++|++
T Consensus         3 ~l~~iii~~i~l~~~~~   19 (130)
T PF12273_consen    3 VLFAIIIVAILLFLFLF   19 (130)
T ss_pred             eeHHHHHHHHHHHHHHH
Confidence            34444444444444433


No 98 
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E. coli GRX2, an atypical GRX with a molecular mass of about 24kD, compared with other GRXs which are 9-12kD in size. GRX2 adopts a GST fold containing an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain. It contains a redox active CXXC motif located in the N-terminal domain but is not able to reduce ribonucleotide reductase like other GRXs. However, it catalyzes GSH-dependent protein disulfide reduction of other substrates efficiently. GRX2 is thought to function primarily  in catalyzing the reversible glutathionylation of proteins in cellular redox regulation including stress responses.
Probab=25.04  E-value=37  Score=21.95  Aligned_cols=14  Identities=29%  Similarity=0.679  Sum_probs=12.4

Q ss_pred             EEEEEeCChhhHHH
Q 030664           45 GLYYESLCPYSANF   58 (173)
Q Consensus        45 ~vyyESlCPd~~~F   58 (173)
                      .+|+-..||+|++-
T Consensus         2 ~Ly~~~~~p~~~rv   15 (71)
T cd03037           2 KLYIYEHCPFCVKA   15 (71)
T ss_pred             ceEecCCCcHhHHH
Confidence            58999999999976


No 99 
>COG4856 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.89  E-value=97  Score=28.38  Aligned_cols=43  Identities=16%  Similarity=0.195  Sum_probs=24.2

Q ss_pred             hHHHHHHHHHHHhcccc-CCCCCCCCCCCC-----CCCeeEEEEEEEeC
Q 030664            9 TKALSLVFYITLFCFLS-GSVSASRTSPSD-----VNSKVKLGLYYESL   51 (173)
Q Consensus         9 ~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~-----~~~kV~V~vyyESl   51 (173)
                      .++|++.++||+..... +--|.++..+..     .-.-|+|++||-+-
T Consensus        13 Iiaff~A~~Lfl~vn~~n~~N~~~t~~~~~~t~~~tltdvpvdvlYD~~   61 (403)
T COG4856          13 IIAFFFAILLFLYVNNNNFNNPISTIKPTSETYTLTLTDVPVDVLYDSD   61 (403)
T ss_pred             HHHHHHHHHhheeecccccCCcccccccccccccceeeeceeEEEEccc
Confidence            34466666666654444 234444443332     24569999999763


No 100
>TIGR02740 TraF-like TraF-like protein. This protein is related to the F-type conjugation system pilus assembly proteins TraF (TIGR02739)and TrbB (TIGR02738) both of which exhibit a thioredoxin fold. The protein represented by this model has the same length and architecture as TraF, but lacks the CXXC-motif found in TrbB and believed to be responsible for the disulfide isomerase activity of that protein.
Probab=24.29  E-value=75  Score=27.08  Aligned_cols=21  Identities=29%  Similarity=0.553  Sum_probs=17.5

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q 030664           39 NSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      .+++-|-.||.+-||.|+.+.
T Consensus       165 ~~k~~Lv~F~AswCp~C~~~~  185 (271)
T TIGR02740       165 AKKSGLFFFFKSDCPYCHQQA  185 (271)
T ss_pred             cCCeEEEEEECCCCccHHHHh
Confidence            456788899999999999863


No 101
>PF08534 Redoxin:  Redoxin;  InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins. Peroxiredoxins (Prxs) constitute a family of thiol peroxidases that reduce hydrogen peroxide, peroxinitrite, and hydroperoxides using a strictly conserved cysteine []. Chloroplast thioredoxin systems in plants regulate the enzymes involved in photosynthetic carbon assimilation []. It is thought that redoxins have a large role to play in anti-oxidant defence. Cadmium-sensitive proteins are also regulated via thioredoxin and glutaredoxin thiol redox systems [].; GO: 0016491 oxidoreductase activity; PDB: 2H30_A 1TP9_A 1Y25_A 1XVQ_A 2B1K_A 2G0F_A 2B1L_B 3K8N_A 1Z5Y_E 3OR5_A ....
Probab=23.53  E-value=1.4e+02  Score=21.75  Aligned_cols=30  Identities=23%  Similarity=0.396  Sum_probs=21.9

Q ss_pred             CCCCeeEEEEEEEe-CChhhHHHHHHhHHHHH
Q 030664           37 DVNSKVKLGLYYES-LCPYSANFIINYLVKIF   67 (173)
Q Consensus        37 ~~~~kV~V~vyyES-lCPd~~~Fi~~qL~P~~   67 (173)
                      .-..|+-|-.+|-+ -||.|+.-+. .|..+.
T Consensus        25 ~~~gk~~vv~f~~~~~Cp~C~~~~p-~l~~l~   55 (146)
T PF08534_consen   25 DFKGKPVVVNFWASAWCPPCRKELP-YLNELQ   55 (146)
T ss_dssp             GGTTSEEEEEEESTTTSHHHHHHHH-HHHHHH
T ss_pred             HhCCCeEEEEEEccCCCCcchhhhh-hHHhhh
Confidence            35577778888888 9999998864 444443


No 102
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins. The non-PICOT members of this family contain only the GRX-like domain, whereas PICOT contains an N-terminal TRX-like domain followed by one to three GRX-like domains. It is interesting to note that PICOT from plants contain three repeats of the GRX-like domain, metazoan proteins (except for insect) have two repeats, while fungal sequences contain only one copy of the domain. PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli. Both GRX and TRX domains of PICOT are required for its activity. Characterized non-PICOT members of this family include CXIP1, a CAX-interacting protein 
Probab=23.51  E-value=55  Score=22.75  Aligned_cols=16  Identities=19%  Similarity=0.494  Sum_probs=12.8

Q ss_pred             EEEEEEEe-----CChhhHHH
Q 030664           43 KLGLYYES-----LCPYSANF   58 (173)
Q Consensus        43 ~V~vyyES-----lCPd~~~F   58 (173)
                      +|.||-.+     .||+|++-
T Consensus         9 ~vvvf~k~~~~~~~Cp~C~~a   29 (90)
T cd03028           9 PVVLFMKGTPEEPRCGFSRKV   29 (90)
T ss_pred             CEEEEEcCCCCCCCCcHHHHH
Confidence            67888774     89999975


No 103
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44. CXXS is still a redox active motif; however, the mixed disulfide formed with the substrate is more stable than those formed by CXXC motif proteins. PDI-related proteins are usually involved in the oxidative protein folding in the ER by acting as catalysts and folding assistants. ERp44 is involved in thiol-mediated retention in the ER.
Probab=23.50  E-value=2e+02  Score=20.13  Aligned_cols=23  Identities=35%  Similarity=0.602  Sum_probs=19.2

Q ss_pred             CCCCeeEEEEEEEeCChhhHHHH
Q 030664           37 DVNSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        37 ~~~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      ...+++-|-.||-+-||.|+++.
T Consensus        15 ~~~g~~vlV~F~a~WC~~C~~~~   37 (100)
T cd02999          15 FNREDYTAVLFYASWCPFSASFR   37 (100)
T ss_pred             hcCCCEEEEEEECCCCHHHHhHh
Confidence            35678888899999999999874


No 104
>PF00578 AhpC-TSA:  AhpC/TSA family;  InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells. Prxs can be regulated by changes to phosphorylation, redox and possibly oligomerisation states. Prxs are divided into three classes: typical 2-Cys Prxs; atypical 2-Cys Prxs; and 1-Cys Prxs. All Prxs share the same basic catalytic mechanism, in which an active-site cysteine (the peroxidatic cysteine) is oxidised to a sulphenic acid by the peroxide substrate. The recycling of the sulphenic acid back to a thiol is what distinguishes the three enzyme classes. Using crystal structures, a detailed catalytic cycle has been derived for typical 2-Cys Prxs, including a model for the redox-regulated oligomeric state proposed to control enzyme activity []. Alkyl hydroperoxide reductase (AhpC) is responsible for directly reducing organic hyperoxides in its reduced dithiol form. Thiol specific antioxidant (TSA) is a physiologically important antioxidant which constitutes an enzymatic defence against sulphur-containing radicals. This family contains AhpC and TSA, as well as related proteins.; GO: 0016209 antioxidant activity, 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1QMV_A 1PRX_B 3HJP_C 3HA9_A 2V41_G 2V32_C 2V2G_C 3LWA_A 3IA1_B 1ZYE_G ....
Probab=23.21  E-value=1.2e+02  Score=21.14  Aligned_cols=30  Identities=13%  Similarity=0.462  Sum_probs=21.3

Q ss_pred             CCeeEEEEEEEe-CChhhHHHHHHhHHHHHhh
Q 030664           39 NSKVKLGLYYES-LCPYSANFIINYLVKIFED   69 (173)
Q Consensus        39 ~~kV~V~vyyES-lCPd~~~Fi~~qL~P~~~~   69 (173)
                      ..|..|-.+|.+ -||.|+.-+ .+|...+++
T Consensus        24 ~gk~~vl~f~~~~~c~~c~~~l-~~l~~~~~~   54 (124)
T PF00578_consen   24 KGKPVVLFFWPTAWCPFCQAEL-PELNELYKK   54 (124)
T ss_dssp             TTSEEEEEEESTTTSHHHHHHH-HHHHHHHHH
T ss_pred             CCCcEEEEEeCccCccccccch-hHHHHHhhh
Confidence            556777777777 999999886 345555543


No 105
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation. Sulfur bacteria oxidize sulfur compounds to provide reducing equivalents for carbon dioxide fixation during autotrophic growth and the respiratory electron transport chain. It is unclear what the role of SoxW is, since it has been found to be dispensable in the oxidation of thiosulfate to sulfate. SoxW is specifically kept in the reduced state by SoxV, which is essential in thiosulfate oxidation.
Probab=23.13  E-value=89  Score=22.47  Aligned_cols=20  Identities=30%  Similarity=0.481  Sum_probs=16.8

Q ss_pred             eeEEEEEEEeCChhhHHHHH
Q 030664           41 KVKLGLYYESLCPYSANFII   60 (173)
Q Consensus        41 kV~V~vyyESlCPd~~~Fi~   60 (173)
                      |+-+-.||-+-||.|+++..
T Consensus        15 k~vlv~f~a~wC~~C~~~~~   34 (125)
T cd02951          15 KPLLLLFSQPGCPYCDKLKR   34 (125)
T ss_pred             CcEEEEEeCCCCHHHHHHHH
Confidence            67777889999999999853


No 106
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold. Members of this family are required for the proper assembly of cytochrome c oxidase (COX). They contain a metal binding motif, typically CXXXC, which is located in a flexible loop. COX, the terminal enzyme in the respiratory chain, is imbedded in the inner mitochondrial membrane of all eukaryotes and in the plasma membrane of some prokaryotes. It is composed of two subunits, COX I and COX II. It has been proposed that Sco1 specifically delivers copper to the CuA site, a dinuclear copper center, of the COX II subunit. Mutations in human Sco1 and Sco2 cause fatal infantile hepatoencephalomyopathy and cardioencephalomyopathy, respectively. Both disorders are associated with severe COX deficiency in affected tissues. More recently, it has been argued that the redox sensitivity of the copper binding properti
Probab=22.85  E-value=2e+02  Score=20.73  Aligned_cols=33  Identities=18%  Similarity=0.252  Sum_probs=24.3

Q ss_pred             CCeeEEEEEEEeCChh-hHHHHHHhHHHHHhhccCCc
Q 030664           39 NSKVKLGLYYESLCPY-SANFIINYLVKIFEDVDLLS   74 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd-~~~Fi~~qL~P~~~~~~l~d   74 (173)
                      ..|+-|-+++-+-||. |++-+. .|...+..  +.+
T Consensus        21 ~gk~~vl~f~~~~C~~~C~~~l~-~l~~~~~~--~~~   54 (142)
T cd02968          21 KGKPVLVYFGYTHCPDVCPTTLA-NLAQALKQ--LGA   54 (142)
T ss_pred             CCCEEEEEEEcCCCcccCHHHHH-HHHHHHHH--hhH
Confidence            5678888888999998 998853 46666654  544


No 107
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox. ThOX proteins are responsible for the generation of hydrogen peroxide, a crucial substrate of thyroperoxidase, which functions to iodinate thyroglobulin and synthesize thyroid hormones. EFP1 was isolated through a yeast two-hybrid method using the EF-hand fragment of dog Duox1 as a bait. It could be one of the partners in the assembly of a multiprotein complex constituting the thyroid hydrogen peroxide generating system. EFP1 contains two TRX domains related to the redox active TRX domains of protein disulfide isomerase (PDI). This subfamily is composed of the N-terminal TRX domain of EFP1, which contains a CXXS sequence in place of the typical CXXC motif, similar to ERp44. The CXXS motif allows the formation of stable mixed disulfides, crucial for the ER-retention function of ERp44.
Probab=22.31  E-value=2.1e+02  Score=20.94  Aligned_cols=21  Identities=24%  Similarity=0.344  Sum_probs=18.3

Q ss_pred             CCCeeEEEEEEEeCChhhHHH
Q 030664           38 VNSKVKLGLYYESLCPYSANF   58 (173)
Q Consensus        38 ~~~kV~V~vyyESlCPd~~~F   58 (173)
                      ...++-|-.||-+-|+.|+.+
T Consensus        27 ~~~~~vlV~FyA~WC~~Ck~l   47 (113)
T cd03006          27 TDAEVSLVMYYAPWDAQSQAA   47 (113)
T ss_pred             cCCCEEEEEEECCCCHHHHHH
Confidence            567788889999999999976


No 108
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein. Dyneins are molecular motors that generate force against microtubules to produce cellular movement, and are divided into two classes: axonemal and cytoplasmic. They are supramolecular complexes consisting of three protein groups classified according to size: dynein heavy, intermediate and light chains. Axonemal dyneins form two structures, the inner and outer arms, which are attached to doublet microtubules throughout the cilia and flagella. The human homolog is the sperm-specific Sptrx-2, presumed to be a  component of the human sperm axoneme architecture. Included in this group is another human protein, TRX-like protein 2, a smaller fusion protein containing one TRX and one NDPK domain, which 
Probab=22.24  E-value=2.8e+02  Score=19.25  Aligned_cols=29  Identities=17%  Similarity=0.229  Sum_probs=20.9

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhHHHHHh
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYLVKIFE   68 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~   68 (173)
                      ..++-|-.||-+-||.|+.+.. .+.++.+
T Consensus        16 ~~~~vvv~F~a~wC~~Ck~~~p-~l~~~~~   44 (102)
T cd02948          16 NKGLTVVDVYQEWCGPCKAVVS-LFKKIKN   44 (102)
T ss_pred             cCCeEEEEEECCcCHhHHHHhH-HHHHHHH
Confidence            3567788899999999998843 3444444


No 109
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2. This small protein is found in three archaeal species so far (Methanococcus jannaschii, Archeoglobus fulgidus, and Methanobacterium thermoautotrophicum) as well as in Anabaena PCC7120. It is homologous to thioredoxins, glutaredoxins, and protein disulfide isomerases, and shares with them a redox-active disulfide. The redox active disulfide region CXXC motif resembles neither thioredoxin nor glutaredoxin. A closely related protein found in the same three Archaea, described by redox_disulf_1, has a glutaredoxin-like CP[YH]C sequence; it has been characterized in functional assays as redox-active but unlikely to be a thioredoxin or glutaredoxin.
Probab=22.19  E-value=2.3e+02  Score=18.80  Aligned_cols=24  Identities=21%  Similarity=0.245  Sum_probs=15.7

Q ss_pred             EEEEEEEeCChhhHHHHHHhHHHHHh
Q 030664           43 KLGLYYESLCPYSANFIINYLVKIFE   68 (173)
Q Consensus        43 ~V~vyyESlCPd~~~Fi~~qL~P~~~   68 (173)
                      +|++|. +-||.|+..- ..+..+.+
T Consensus         2 ~i~~~a-~~C~~C~~~~-~~~~~~~~   25 (76)
T TIGR00412         2 KIQIYG-TGCANCQMTE-KNVKKAVE   25 (76)
T ss_pred             EEEEEC-CCCcCHHHHH-HHHHHHHH
Confidence            467776 9999999762 33444444


No 110
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein. QSOX oxidizes thiol groups to disulfides like PDI, however, unlike PDI, this oxidation is accompanied by the reduction of oxygen to hydrogen peroxide. QSOX is localized in high concentrations in cells with heavy secretory load and prefers peptides and proteins as substrates, not monothiols like glutathione. Inside the cell, QSOX is found in the endoplasmic reticulum and Golgi. The flow of reducing equivalents in a QSOX-catalyzed reaction goes from the dithiol substrate - dithiol of the QSOX TRX domain - dithiols of the QSOX ERV1p domain - FAD - oxygen.
Probab=21.80  E-value=3.1e+02  Score=19.65  Aligned_cols=21  Identities=24%  Similarity=0.373  Sum_probs=17.3

Q ss_pred             CCeeEEEEEEEeCChhhHHHH
Q 030664           39 NSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      .++.-|-.||-+-||.|+.+.
T Consensus        18 ~~~~vvV~f~a~wC~~C~~~~   38 (114)
T cd02992          18 SPSAWLVEFYASWCGHCRAFA   38 (114)
T ss_pred             CCCeEEEEEECCCCHHHHHHh
Confidence            346788889999999999884


No 111
>PRK13675 GTP cyclohydrolase; Provisional
Probab=21.65  E-value=1.4e+02  Score=26.22  Aligned_cols=29  Identities=10%  Similarity=0.209  Sum_probs=21.4

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhHHHHH
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYLVKIF   67 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~   67 (173)
                      .-.+.|+|.|.|+||=|+......+...+
T Consensus       144 ~~~l~v~V~~~T~CPCS~~is~~~~~~~~  172 (308)
T PRK13675        144 RKEIGAEVVGMTACPCAQEMMKERARKKL  172 (308)
T ss_pred             EEEEEEEEEEEEcChhhHHHHHHHHHHhh
Confidence            45689999999999998887654333333


No 112
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functio
Probab=21.61  E-value=81  Score=20.07  Aligned_cols=19  Identities=11%  Similarity=0.169  Sum_probs=15.6

Q ss_pred             eeEEEEEEEeCChhhHHHH
Q 030664           41 KVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        41 kV~V~vyyESlCPd~~~Fi   59 (173)
                      ++-+-+||..-||.|+.+.
T Consensus        11 ~~~ll~~~~~~C~~C~~~~   29 (93)
T cd02947          11 KPVVVDFWAPWCGPCKAIA   29 (93)
T ss_pred             CcEEEEEECCCChhHHHhh
Confidence            5668888888999999774


No 113
>PHA00407 phage lambda Rz1-like protein
Probab=21.29  E-value=1.3e+02  Score=21.45  Aligned_cols=33  Identities=27%  Similarity=0.177  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHhccccCCCCCCCCCCCCCCCeeEEE--EEEE
Q 030664           11 ALSLVFYITLFCFLSGSVSASRTSPSDVNSKVKLG--LYYE   49 (173)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kV~V~--vyyE   49 (173)
                      -+.+.++.+|+-|+|.+      .+..+.+||.|+  +.+|
T Consensus        37 Glllicv~tISGCaSes------~lp~ep~k~TVDaSLMVe   71 (84)
T PHA00407         37 GLLLICVATISGCASES------NLPVEPQKVTVDASLMVE   71 (84)
T ss_pred             HHHHHHHHHHhhhhhcc------cCCCCcccceeeeeeeeC
Confidence            34555666777666665      234455665554  4444


No 114
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit. This family of thioredoxin reductase homologs is found adjacent to alkylhydroperoxide reductase C subunit predominantly in cases where there is only one C subunit in the genome and that genome is lacking the F subunit partner (also a thioredcxin reductase homolog) that is usually found (TIGR03140).
Probab=21.21  E-value=1.8e+02  Score=27.10  Aligned_cols=23  Identities=9%  Similarity=0.300  Sum_probs=19.6

Q ss_pred             CCCCeeEEEEEEEeCChhhHHHH
Q 030664           37 DVNSKVKLGLYYESLCPYSANFI   59 (173)
Q Consensus        37 ~~~~kV~V~vyyESlCPd~~~Fi   59 (173)
                      .-+.+++|.+|+-.-||+|.+-.
T Consensus       473 ~~~~~~~i~v~~~~~C~~Cp~~~  495 (555)
T TIGR03143       473 KITKPVNIKIGVSLSCTLCPDVV  495 (555)
T ss_pred             hcCCCeEEEEEECCCCCCcHHHH
Confidence            44678999999999999999764


No 115
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes. It inhibits transcription by binding to the C-terminal domain of the alpha subunit of RNAP, disrupting complex formation between RNAP and certain transcriptional activator proteins like ResD and ComA. In response to oxidative stress, Spx can also activate transcription, making it a general regulator that exerts both positive and negative control over transcription initiation. Spx has been shown to exert redox-sensitive transcriptional control over genes like trxA (TRX) and trxB (TRX reductase), genes that function in thiol homeostasis. This redox-sensitive activity is dependent on the presence of a CXXC motif, present in some members of the Spx subfamily, that acts as a thiol/disulfide switch. Spx has also been shown to repress genes in a sulfate-dependent manner independent of the presence of the CXXC motif.
Probab=21.19  E-value=84  Score=22.89  Aligned_cols=32  Identities=13%  Similarity=0.195  Sum_probs=21.7

Q ss_pred             EEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEee
Q 030664           44 LGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWG   84 (173)
Q Consensus        44 V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G   84 (173)
                      |++|+-..||.|++-. +.|-    .    .-++++++.+.
T Consensus         2 i~iY~~~~C~~c~ka~-~~L~----~----~gi~~~~idi~   33 (115)
T cd03032           2 IKLYTSPSCSSCRKAK-QWLE----E----HQIPFEERNLF   33 (115)
T ss_pred             EEEEeCCCCHHHHHHH-HHHH----H----CCCceEEEecC
Confidence            6899999999999864 2232    2    12566776664


No 116
>smart00594 UAS UAS domain.
Probab=21.17  E-value=50  Score=24.24  Aligned_cols=43  Identities=14%  Similarity=0.110  Sum_probs=26.7

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEeee
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGN   85 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G~   85 (173)
                      ..|.-+-..+-.-|++|+.|.++.|    .++++.++++=++|.|+-
T Consensus        26 ~~K~~lv~~~~~~c~~c~~~~r~vl----~~~~V~~~i~~~fv~~~~   68 (122)
T smart00594       26 QRRLLWLYLHSQDSPDSQVFNRDVL----CNEAVKSLIRENFIFWQV   68 (122)
T ss_pred             hcCCEEEEEeCCCCchHHHHHHHHc----cCHHHHHHHHcCEEEEEe
Confidence            3444444445556999999986544    344555666656777764


No 117
>PF04134 DUF393:  Protein of unknown function, DUF393;  InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG. Proteins in this family are predicted to have a thioredoxin-like fold which, together with the presence of an invariant catalytic cysteine residue, suggests that they are a novel group of thiol-disulphide oxidoreductases []. As some of the bacterial proteins are encoded near penicillin-binding proteins, it has been suggested that these may be involved in redox regulation of cell wall biosynthesis [].
Probab=20.78  E-value=1.1e+02  Score=21.68  Aligned_cols=32  Identities=16%  Similarity=0.165  Sum_probs=22.2

Q ss_pred             EEEEeCChhhHHHHHHhHHHHHhhccCCceeeEEEEEee
Q 030664           46 LYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWG   84 (173)
Q Consensus        46 vyyESlCPd~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G   84 (173)
                      |+|-.-||-|.+++.- +.    +  ....=.|+++|+.
T Consensus         1 v~YDg~C~lC~~~~~~-l~----~--~d~~~~l~~~~~~   32 (114)
T PF04134_consen    1 VFYDGDCPLCRREVRF-LR----R--RDRGGRLRFVDIQ   32 (114)
T ss_pred             CEECCCCHhHHHHHHH-HH----h--cCCCCCEEEEECC
Confidence            6899999999999743 22    1  3334557888873


No 118
>TIGR03399 RNA_3prim_cycl RNA 3'-phosphate cyclase. Members of this protein family are RNA 3'-phosphate cyclase (6.5.1.4), an enzyme whose function is conserved from E. coli to human. The modification this enzyme performs enables certain RNA ligations to occur, although the full biological roll for this enzyme is not fully described. This model separates this enzyme from a related protein, present only in eukaryotes, localized to the nucleolus, and involved in ribosomal modification.
Probab=20.69  E-value=4.2e+02  Score=23.36  Aligned_cols=62  Identities=19%  Similarity=0.267  Sum_probs=45.8

Q ss_pred             chhHHHHHHHHHHHhccccCCCCCCCCCCCCCCCeeEEEEEEEeCChh--hHHHHHHhHHHHHhhccCCceeeEEEEEee
Q 030664            7 SSTKALSLVFYITLFCFLSGSVSASRTSPSDVNSKVKLGLYYESLCPY--SANFIINYLVKIFEDVDLLSIVDLHLSPWG   84 (173)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~kV~V~vyyESlCPd--~~~Fi~~qL~P~~~~~~l~d~vdl~lvP~G   84 (173)
                      |.++++-.++.+.+|.                ..++.+++-.-+.-|-  +.+|+++.+.|++.+  +.-.+++++.=.|
T Consensus        93 Si~l~lq~lLp~l~f~----------------~~p~~l~l~GgT~~~~sPsvDy~~~v~lP~l~~--~G~~~~l~v~rRG  154 (326)
T TIGR03399        93 SVTLVLQTLLPALLFA----------------NGPSRVTVSGGTDVPWAPPVDYLRNVFLPLLER--MGIRAELELLRRG  154 (326)
T ss_pred             hhHHHHHHHHHHHHhC----------------CCCeEEEEEcccCCCCCCCHHHHHHHHHHHHHh--CCCcEEEEEEeCC
Confidence            4455666666666661                2356788888887776  899999999999987  6666899988776


Q ss_pred             ee
Q 030664           85 NA   86 (173)
Q Consensus        85 ~A   86 (173)
                      ..
T Consensus       155 ~y  156 (326)
T TIGR03399       155 FY  156 (326)
T ss_pred             cC
Confidence            54


No 119
>cd02966 TlpA_like_family TlpA-like family; composed of  TlpA, ResA, DsbE and similar proteins. TlpA, ResA and DsbE are bacterial protein disulfide reductases with important roles in cytochrome maturation. They are membrane-anchored proteins with a soluble TRX domain containing a CXXC motif located in the periplasm. The TRX domains of this family contain an insert, approximately 25 residues in length, which correspond to an extra alpha helix and a beta strand when compared with TRX. TlpA catalyzes an essential reaction in the biogenesis of cytochrome aa3, while ResA and DsbE are essential proteins in cytochrome c maturation. Also included in this family are proteins containing a TlpA-like TRX domain with domain architectures similar to E. coli DipZ protein, and the N-terminal TRX domain of PilB protein from Neisseria which acts as a disulfide reductase that can recylce methionine sulfoxide reductases.
Probab=20.39  E-value=2.7e+02  Score=18.32  Aligned_cols=30  Identities=23%  Similarity=0.344  Sum_probs=21.7

Q ss_pred             CCeeEEEEEEEeCChhhHHHHHHhHHHHHhh
Q 030664           39 NSKVKLGLYYESLCPYSANFIINYLVKIFED   69 (173)
Q Consensus        39 ~~kV~V~vyyESlCPd~~~Fi~~qL~P~~~~   69 (173)
                      ..|.-|-.++-+-||.|++++ ..|....++
T Consensus        18 ~~k~~ll~f~~~~C~~C~~~~-~~l~~~~~~   47 (116)
T cd02966          18 KGKVVLVNFWASWCPPCRAEM-PELEALAKE   47 (116)
T ss_pred             CCCEEEEEeecccChhHHHHh-HHHHHHHHH
Confidence            367788888889999999874 445555443


Done!