BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030680
         (173 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1QKI|A Chain A, X-Ray Structure Of Human Glucose 6-Phosphate Dehydrogenase
           (Variant Canton R459l) Complexed With Structural Nadp+
 pdb|1QKI|B Chain B, X-Ray Structure Of Human Glucose 6-Phosphate Dehydrogenase
           (Variant Canton R459l) Complexed With Structural Nadp+
 pdb|1QKI|C Chain C, X-Ray Structure Of Human Glucose 6-Phosphate Dehydrogenase
           (Variant Canton R459l) Complexed With Structural Nadp+
 pdb|1QKI|D Chain D, X-Ray Structure Of Human Glucose 6-Phosphate Dehydrogenase
           (Variant Canton R459l) Complexed With Structural Nadp+
 pdb|1QKI|E Chain E, X-Ray Structure Of Human Glucose 6-Phosphate Dehydrogenase
           (Variant Canton R459l) Complexed With Structural Nadp+
 pdb|1QKI|F Chain F, X-Ray Structure Of Human Glucose 6-Phosphate Dehydrogenase
           (Variant Canton R459l) Complexed With Structural Nadp+
 pdb|1QKI|G Chain G, X-Ray Structure Of Human Glucose 6-Phosphate Dehydrogenase
           (Variant Canton R459l) Complexed With Structural Nadp+
 pdb|1QKI|H Chain H, X-Ray Structure Of Human Glucose 6-Phosphate Dehydrogenase
           (Variant Canton R459l) Complexed With Structural Nadp+
          Length = 514

 Score =  171 bits (432), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 122/174 (70%), Gaps = 7/174 (4%)

Query: 1   MQNHLLQILALFAMETPVSLDAEDIRNEKVKVLRPMQQLLLEDVIVGQYKGHNKG-SKSY 59
           MQNHLLQ+L L AME P S +++D+R+EKVKVL+ + ++   +V++GQY G+  G  ++ 
Sbjct: 259 MQNHLLQMLCLVAMEKPASTNSDDVRDEKVKVLKCISEVQANNVVLGQYVGNPDGEGEAT 318

Query: 60  PAYIDDPTVPKDSLTPTFAAAALFINNARWDGVPFLMKAGKALHTKRAEIRVQFRHVPGN 119
             Y+DDPTVP+ S T TFAA  L++ N RWDGVPF+++ GKAL+ ++AE+R+QF  V G+
Sbjct: 319 KGYLDDPTVPRGSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQFHDVAGD 378

Query: 120 LYKRNFGTDLDKATNELVLRLQPDEAIYLKINNKVPGLGMRLDRSDLNLLYRSR 173
           ++ +          NELV+R+QP+EA+Y K+  K PG+    + S+L+L Y +R
Sbjct: 379 IFHQQC------KRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNR 426


>pdb|2BH9|A Chain A, X-Ray Structure Of A Deletion Variant Of Human Glucose 6-
           Phosphate Dehydrogenase Complexed With Structural And
           Coenzyme Nadp
 pdb|2BHL|A Chain A, X-Ray Structure Of Human Glucose-6-Phosphate Dehydrogenase
           (Deletion Variant) Complexed With Glucose-6-Phosphate
 pdb|2BHL|B Chain B, X-Ray Structure Of Human Glucose-6-Phosphate Dehydrogenase
           (Deletion Variant) Complexed With Glucose-6-Phosphate
          Length = 489

 Score =  170 bits (431), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 80/174 (45%), Positives = 122/174 (70%), Gaps = 7/174 (4%)

Query: 1   MQNHLLQILALFAMETPVSLDAEDIRNEKVKVLRPMQQLLLEDVIVGQYKGHNKG-SKSY 59
           MQNHLLQ+L L AME P S +++D+R+EKVKVL+ + ++   +V++GQY G+  G  ++ 
Sbjct: 234 MQNHLLQMLCLVAMEKPASTNSDDVRDEKVKVLKCISEVQANNVVLGQYVGNPDGEGEAT 293

Query: 60  PAYIDDPTVPKDSLTPTFAAAALFINNARWDGVPFLMKAGKALHTKRAEIRVQFRHVPGN 119
             Y+DDPTVP+ S T TFAA  L++ N RWDGVPF+++ GKAL+ ++AE+R+QF  V G+
Sbjct: 294 KGYLDDPTVPRGSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQFHDVAGD 353

Query: 120 LYKRNFGTDLDKATNELVLRLQPDEAIYLKINNKVPGLGMRLDRSDLNLLYRSR 173
           ++ +          NELV+R+QP+EA+Y K+  K PG+    + S+L+L Y +R
Sbjct: 354 IFHQQC------KRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNR 401


>pdb|4E9I|A Chain A, Glucose-6-P Dehydrogenase (Apo Form) From Trypanosoma
           Cruzi
 pdb|4E9I|B Chain B, Glucose-6-P Dehydrogenase (Apo Form) From Trypanosoma
           Cruzi
 pdb|4E9I|C Chain C, Glucose-6-P Dehydrogenase (Apo Form) From Trypanosoma
           Cruzi
 pdb|4E9I|D Chain D, Glucose-6-P Dehydrogenase (Apo Form) From Trypanosoma
           Cruzi
 pdb|4EM5|A Chain A, Trypanosoma Cruzi Glucose-6-P Dehydrogenase In Complex
           With G6p
 pdb|4EM5|B Chain B, Trypanosoma Cruzi Glucose-6-P Dehydrogenase In Complex
           With G6p
 pdb|4EM5|C Chain C, Trypanosoma Cruzi Glucose-6-P Dehydrogenase In Complex
           With G6p
 pdb|4EM5|D Chain D, Trypanosoma Cruzi Glucose-6-P Dehydrogenase In Complex
           With G6p
          Length = 541

 Score =  154 bits (390), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 109/173 (63%), Gaps = 9/173 (5%)

Query: 1   MQNHLLQILALFAMETPVSLDAEDIRNEKVKVLRPMQQLLLEDVIVGQYKGHNKGSKSYP 60
           +QNHL QIL+L  ME P SL AEDIR+EKV+VLR +      + ++GQY     GS   P
Sbjct: 292 IQNHLTQILSLLTMEKPRSLSAEDIRDEKVQVLRQVVPANPAECVLGQYTASADGST--P 349

Query: 61  AYIDDPTVPKDSLTPTFAAAALFINNARWDGVPFLMKAGKALHTKRAEIRVQFRHVPGNL 120
            Y+DDP+VPK S  PTFA   L +NN RW GVPF+++AGKAL  +  +IR+QF+      
Sbjct: 350 GYLDDPSVPKGSHCPTFAVLRLHVNNDRWHGVPFIIRAGKALEERLLDIRIQFKD----- 404

Query: 121 YKRNFGTDLDKATNELVLRLQPDEAIYLKINNKVPGLGMRLDRSDLNLLYRSR 173
             R FG    +  NELV+R QP EA+YLK+  K PGL     +++L+L Y  R
Sbjct: 405 EIRPFGESTQR--NELVIRAQPSEAMYLKLTAKTPGLLNDTHQTELDLTYERR 455


>pdb|1E77|A Chain A, Complex Of Active Mutant (Q365->c) Of Glucose 6-Phosphate
           Dehydrogenase From Leuconostoc Mesenteroides With
           Substrate
 pdb|1H9A|A Chain A, Complex Of Active Mutant (Q365->c) Of Glucose 6-Phosphate
           Dehydrogenase From L. Mesenteroides With Coenzyme Nadp
 pdb|1H9B|A Chain A, Active Mutant (Q365->c) Of Glucose 6-Phosphate
           Dehydrogenase From Leuconostoc Mesenteroides
          Length = 485

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 80/157 (50%), Gaps = 11/157 (7%)

Query: 1   MQNHLLQILALFAMETPVSLDAEDIRNEKVKVLRPMQQLLLEDVIVGQY---KGHNKG-S 56
           +QNH +QI+   AME P S   +DIR  K      ++  + ++  V +Y     +  G S
Sbjct: 237 IQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALK--IYDEAEVNKYFVRAQYGAGDS 294

Query: 57  KSYPAYIDDPTVPKDSLTPTFAAAALFINNARWDGVPFLMKAGKALHTKRAEIRVQFRHV 116
             +  Y+++  VP DS   TF A  L  +  RW+GVPF +++GK L  K+  + + F+  
Sbjct: 295 ADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFK-- 352

Query: 117 PGNLYKRNFGTDLDKATNELVLRLQPDEAIYLKINNK 153
            G     NFG++ +     L + + P  AI LK+N K
Sbjct: 353 AGTF---NFGSEQEACEAVLSIIIDPKGAIELKLNAK 386


>pdb|1DPG|A Chain A, Glucose 6-Phosphate Dehydrogenase From Leuconostoc
           Mesenteroides
 pdb|1DPG|B Chain B, Glucose 6-Phosphate Dehydrogenase From Leuconostoc
           Mesenteroides
          Length = 485

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 80/157 (50%), Gaps = 11/157 (7%)

Query: 1   MQNHLLQILALFAMETPVSLDAEDIRNEKVKVLRPMQQLLLEDVIVGQY---KGHNKG-S 56
           +QNH +QI+   AME P S   +DIR  K      ++  + ++  V +Y     +  G S
Sbjct: 237 IQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALK--IYDEAEVNKYFVRAQYGAGDS 294

Query: 57  KSYPAYIDDPTVPKDSLTPTFAAAALFINNARWDGVPFLMKAGKALHTKRAEIRVQFRHV 116
             +  Y+++  VP DS   TF A  L  +  RW+GVPF +++GK L  K+  + + F+  
Sbjct: 295 ADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFK-- 352

Query: 117 PGNLYKRNFGTDLDKATNELVLRLQPDEAIYLKINNK 153
            G     NFG++ +     L + + P  AI LK+N K
Sbjct: 353 AGTF---NFGSEQEAQEAVLSIIIDPKGAIELKLNAK 386


>pdb|1H93|A Chain A, Active Mutant (S215->c) Of Glucose 6-Phosphate
           Dehydrogenase From Leuconostoc Mesenteroides
 pdb|1H94|A Chain A, Complex Of Active Mutant (S215->c) Of Glucose 6-Phosphate
           Dehydrogenase From L.Mesenteroides With Coenzyme Nad
          Length = 485

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 80/157 (50%), Gaps = 11/157 (7%)

Query: 1   MQNHLLQILALFAMETPVSLDAEDIRNEKVKVLRPMQQLLLEDVIVGQY---KGHNKG-S 56
           +QNH +QI+   AME P S   +DIR  K      ++  + ++  V +Y     +  G S
Sbjct: 237 IQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALK--IYDEAEVNKYFVRAQYGAGDS 294

Query: 57  KSYPAYIDDPTVPKDSLTPTFAAAALFINNARWDGVPFLMKAGKALHTKRAEIRVQFRHV 116
             +  Y+++  VP DS   TF A  L  +  RW+GVPF +++GK L  K+  + + F+  
Sbjct: 295 ADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFK-- 352

Query: 117 PGNLYKRNFGTDLDKATNELVLRLQPDEAIYLKINNK 153
            G     NFG++ +     L + + P  AI LK+N K
Sbjct: 353 AGTF---NFGSEQEAQEAVLSIIIDPKGAIELKLNAK 386


>pdb|1E7M|A Chain A, Active Site Mutant (D177->n) Of Glucose 6-Phosphate
           Dehydrogenase From Leuconostoc Mesenteroides
 pdb|1E7Y|A Chain A, Active Site Mutant (D177->n) Of Glucose 6-Phosphate
           Dehydrogenase From Leuconostoc Mesenteroides Complexed
           With Substrate And Nadph
          Length = 485

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 80/157 (50%), Gaps = 11/157 (7%)

Query: 1   MQNHLLQILALFAMETPVSLDAEDIRNEKVKVLRPMQQLLLEDVIVGQY---KGHNKG-S 56
           +QNH +QI+   AME P S   +DIR  K      ++  + ++  V +Y     +  G S
Sbjct: 237 IQNHTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALK--IYDEAEVNKYFVRAQYGAGDS 294

Query: 57  KSYPAYIDDPTVPKDSLTPTFAAAALFINNARWDGVPFLMKAGKALHTKRAEIRVQFRHV 116
             +  Y+++  VP DS   TF A  L  +  RW+GVPF +++GK L  K+  + + F+  
Sbjct: 295 ADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFK-- 352

Query: 117 PGNLYKRNFGTDLDKATNELVLRLQPDEAIYLKINNK 153
            G     NFG++ +     L + + P  AI LK+N K
Sbjct: 353 AGTF---NFGSEQEAQEAVLSIIIDPKGAIELKLNAK 386


>pdb|2DPG|A Chain A, Complex Of Inactive Mutant (H240->n) Of Glucose
           6-Phosphate Dehydrogenase From Leuconostoc Mesenteroides
           With Nadp+
          Length = 485

 Score = 73.2 bits (178), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 80/157 (50%), Gaps = 11/157 (7%)

Query: 1   MQNHLLQILALFAMETPVSLDAEDIRNEKVKVLRPMQQLLLEDVIVGQY---KGHNKG-S 56
           +QN+ +QI+   AME P S   +DIR  K      ++  + ++  V +Y     +  G S
Sbjct: 237 IQNNTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALK--IYDEAEVNKYFVRAQYGAGDS 294

Query: 57  KSYPAYIDDPTVPKDSLTPTFAAAALFINNARWDGVPFLMKAGKALHTKRAEIRVQFRHV 116
             +  Y+++  VP DS   TF A  L  +  RW+GVPF +++GK L  K+  + + F+  
Sbjct: 295 ADFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFK-- 352

Query: 117 PGNLYKRNFGTDLDKATNELVLRLQPDEAIYLKINNK 153
            G     NFG++ +     L + + P  AI LK+N K
Sbjct: 353 AGTF---NFGSEQEAQEAVLSIIIDPKGAIELKLNAK 386


>pdb|3LJK|A Chain A, Glucose-6-Phosphate Isomerase From Francisella Tularensis.
 pdb|3M5P|A Chain A, Glucose-6-Phosphate Isomerase From Francisella Tularensis
           Complexed With Fructose-6-Phosphate
          Length = 543

 Score = 28.5 bits (62), Expect = 1.9,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 16  TPVSLDAEDIRNEKVKVLRPMQQLLLEDVIVGQYKG 51
           TP+ +D +DIR E  K  + +++ L+E V+ G+++G
Sbjct: 100 TPLIVDGQDIRQEVTKEKQRVKE-LVEKVVSGRWRG 134


>pdb|3Q88|A Chain A, Glucose-6-Phosphate Isomerase From Francisella Tularensis
           Complexed With Ribose 1,5-Bisphosphate.
 pdb|3Q7I|A Chain A, Glucose-6-Phosphate Isomerase From Francisella Tularensis
           Complexed With 6-Phosphogluconic Acid
          Length = 543

 Score = 28.5 bits (62), Expect = 2.0,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 16  TPVSLDAEDIRNEKVKVLRPMQQLLLEDVIVGQYKG 51
           TP+ +D +DIR E  K  + +++ L+E V+ G+++G
Sbjct: 100 TPLIVDGQDIRQEVTKEKQRVKE-LVEKVVSGRWRG 134


>pdb|2FFX|J Chain J, Structure Of Human Ferritin L. Chain
          Length = 173

 Score = 27.3 bits (59), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 122 KRNFGTDLDKATNELVLRLQPDEAIYLKINNKVPGLGMRLDRSDLNL 168
           ++N+ TD++ A N LV        +YL+ +     LG   DR D+ L
Sbjct: 5   RQNYSTDVEAAVNSLV-------NLYLQASYTYLSLGFYFDRDDVAL 44


>pdb|2FG4|A Chain A, Structure Of Human Ferritin L Chain
 pdb|2FG8|A Chain A, Structure Of Human Ferritin L Chain
 pdb|2FG8|B Chain B, Structure Of Human Ferritin L Chain
 pdb|2FG8|C Chain C, Structure Of Human Ferritin L Chain
 pdb|2FG8|D Chain D, Structure Of Human Ferritin L Chain
 pdb|2FG8|E Chain E, Structure Of Human Ferritin L Chain
 pdb|2FG8|F Chain F, Structure Of Human Ferritin L Chain
 pdb|2FG8|G Chain G, Structure Of Human Ferritin L Chain
 pdb|2FG8|H Chain H, Structure Of Human Ferritin L Chain
          Length = 174

 Score = 27.3 bits (59), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 122 KRNFGTDLDKATNELVLRLQPDEAIYLKINNKVPGLGMRLDRSDLNL 168
           ++N+ TD++ A N LV        +YL+ +     LG   DR D+ L
Sbjct: 5   RQNYSTDVEAAVNSLV-------NLYLQASYTYLSLGFYFDRDDVAL 44


>pdb|3KXU|A Chain A, Crystal Structure Of Human Ferritin Ftl498instc Pathogenic
           M
          Length = 191

 Score = 27.3 bits (59), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 122 KRNFGTDLDKATNELVLRLQPDEAIYLKINNKVPGLGMRLDRSDLNL 168
           ++N+ TD++ A N LV        +YL+ +     LG   DR D+ L
Sbjct: 6   RQNYSTDVEAAVNSLV-------NLYLQASYTYLSLGFYFDRDDVAL 45


>pdb|3HX2|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|AA Chain a, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|B Chain B, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|BB Chain b, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|C Chain C, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|CC Chain c, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|D Chain D, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|DD Chain d, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|E Chain E, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|EE Chain e, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|F Chain F, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|FF Chain f, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|G Chain G, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|GG Chain g, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|H Chain H, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|HH Chain h, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|I Chain I, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|II Chain i, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|J Chain J, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|JJ Chain j, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|K Chain K, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|KK Chain k, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|L Chain L, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|LL Chain l, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|M Chain M, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|MM Chain m, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|N Chain N, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|NN Chain n, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|O Chain O, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|OO Chain o, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|P Chain P, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|PP Chain p, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|Q Chain Q, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|QQ Chain q, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|R Chain R, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|RR Chain r, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|S Chain S, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|SS Chain s, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|T Chain T, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|TT Chain t, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|U Chain U, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|UU Chain u, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|V Chain V, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|VV Chain v, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|W Chain W, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|WW Chain w, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|X Chain X, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX2|XX Chain x, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 13 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 1 And 2 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|AA Chain a, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|B Chain B, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|BB Chain b, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|C Chain C, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|CC Chain c, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|D Chain D, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|DD Chain d, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|E Chain E, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|EE Chain e, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|F Chain F, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|FF Chain f, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|G Chain G, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|GG Chain g, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|H Chain H, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|HH Chain h, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|I Chain I, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|II Chain i, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|J Chain J, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|JJ Chain j, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|K Chain K, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|KK Chain k, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|L Chain L, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|LL Chain l, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|M Chain M, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|MM Chain m, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|N Chain N, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|NN Chain n, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|O Chain O, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|OO Chain o, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|P Chain P, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|PP Chain p, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|Q Chain Q, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|QQ Chain q, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|R Chain R, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|RR Chain r, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|S Chain S, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|SS Chain s, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|T Chain T, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|TT Chain t, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|U Chain U, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|UU Chain u, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|V Chain V, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|VV Chain v, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|W Chain W, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|WW Chain w, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|X Chain X, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX5|XX Chain x, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 23 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 3 And 4 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|A Chain A, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|AA Chain a, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|B Chain B, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|BB Chain b, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|C Chain C, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|CC Chain c, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|D Chain D, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|DD Chain d, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|E Chain E, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|EE Chain e, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|F Chain F, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|FF Chain f, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|G Chain G, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|GG Chain g, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|H Chain H, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|HH Chain h, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|I Chain I, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|II Chain i, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|J Chain J, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|JJ Chain j, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|K Chain K, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|KK Chain k, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|L Chain L, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|LL Chain l, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|M Chain M, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|MM Chain m, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|N Chain N, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|NN Chain n, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|O Chain O, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|OO Chain o, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|P Chain P, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|PP Chain p, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|Q Chain Q, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|QQ Chain q, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|R Chain R, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|RR Chain r, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|S Chain S, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|SS Chain s, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|T Chain T, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|TT Chain t, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|U Chain U, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|UU Chain u, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|V Chain V, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|VV Chain v, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|W Chain W, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|WW Chain w, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|X Chain X, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
 pdb|3HX7|XX Chain x, Crystal Structure Of Human Ferritin Phe167serfsx26 Mutant.
           This File Is A Part 33 OF THE SPLIT ENTRY AND CONTAINS
           THE Copies 5 And 6 Of The Total Six Copies Of The
           Biological Unit That Are Present In The Crystallographic
           Asymmetric Unit. The Entire Structure Contains Six
           Copies Of The Biological Unit In The Crystallographic
           Asymmetric Unit And Is Described In Remark 400
          Length = 192

 Score = 26.9 bits (58), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 7/47 (14%)

Query: 122 KRNFGTDLDKATNELVLRLQPDEAIYLKINNKVPGLGMRLDRSDLNL 168
           ++N+ TD++ A N LV        +YL+ +     LG   DR D+ L
Sbjct: 7   RQNYSTDVEAAVNSLV-------NLYLQASYTYLSLGFYFDRDDVAL 46


>pdb|1FM4|A Chain A, Crystal Structure Of The Birch Pollen Allergen Bet V 1l
          Length = 159

 Score = 26.9 bits (58), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 126 GTDLDKATNELVLRLQPDEAIYLKINNK 153
           G  L+K +NE+ +   PD    LKI+NK
Sbjct: 92  GDTLEKISNEIKIVATPDGGCVLKISNK 119


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.138    0.398 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,075,958
Number of Sequences: 62578
Number of extensions: 203953
Number of successful extensions: 457
Number of sequences better than 100.0: 23
Number of HSP's better than 100.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 426
Number of HSP's gapped (non-prelim): 23
length of query: 173
length of database: 14,973,337
effective HSP length: 92
effective length of query: 81
effective length of database: 9,216,161
effective search space: 746509041
effective search space used: 746509041
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)