BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030719
         (172 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866
 pdb|2HYD|B Chain B, Multidrug Abc Transporter Sav1866
 pdb|2ONJ|A Chain A, Structure Of The Multidrug Abc Transporter Sav1866 From S.
           Aureus In Complex With Amp-Pnp
 pdb|2ONJ|B Chain B, Structure Of The Multidrug Abc Transporter Sav1866 From S.
           Aureus In Complex With Amp-Pnp
 pdb|4A82|A Chain A, Fitted Model Of Staphylococcus Aureus Sav1866 Model Abc
           Transporter In The Human Cystic Fibrosis Transmembrane
           Conductance Regulator Volume Map Emd-1966.
 pdb|4A82|B Chain B, Fitted Model Of Staphylococcus Aureus Sav1866 Model Abc
           Transporter In The Human Cystic Fibrosis Transmembrane
           Conductance Regulator Volume Map Emd-1966.
 pdb|4A82|C Chain C, Fitted Model Of Staphylococcus Aureus Sav1866 Model Abc
           Transporter In The Human Cystic Fibrosis Transmembrane
           Conductance Regulator Volume Map Emd-1966.
 pdb|4A82|D Chain D, Fitted Model Of Staphylococcus Aureus Sav1866 Model Abc
           Transporter In The Human Cystic Fibrosis Transmembrane
           Conductance Regulator Volume Map Emd-1966
          Length = 578

 Score = 27.7 bits (60), Expect = 3.0,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 80  GPQKQRFVIKTEYVNHPLFKLLLEEAESEYGFQSE 114
           G QKQR  I   ++N+P   L+L+EA S    +SE
Sbjct: 480 GGQKQRLSIARIFLNNPPI-LILDEATSALDLESE 513


>pdb|2YQC|A Chain A, Crystal Structure Of Uridine-Diphospho-N-Acetylglucosamine
           Pyrophosphorylase From Candida Albicans, In The Apo-Like
           Form
 pdb|2YQH|A Chain A, Crystal Structure Of Uridine-Diphospho-N-Acetylglucosamine
           Pyrophosphorylase From Candida Albicans, In The
           Substrate-Binding Form
 pdb|2YQH|B Chain B, Crystal Structure Of Uridine-Diphospho-N-Acetylglucosamine
           Pyrophosphorylase From Candida Albicans, In The
           Substrate-Binding Form
 pdb|2YQJ|A Chain A, Crystal Structure Of Uridine-Diphospho-N-Acetylglucosamine
           Pyrophosphorylase From Candida Albicans, In The
           Reaction-Completed Form
 pdb|2YQJ|B Chain B, Crystal Structure Of Uridine-Diphospho-N-Acetylglucosamine
           Pyrophosphorylase From Candida Albicans, In The
           Reaction-Completed Form
 pdb|2YQS|A Chain A, Crystal Structure Of Uridine-Diphospho-N-Acetylglucosamine
           Pyrophosphorylase From Candida Albicans, In The
           Product-Binding Form
          Length = 486

 Score = 26.9 bits (58), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 70  APEGCFSVYVGPQKQRFVIKTEYVNHPLFKLLLEEAESEYGFQSEGPLV 118
           AP+GCF++ +  QK  F I+ E +      L +E+   +Y   ++ P++
Sbjct: 121 APKGCFNIELPSQKSLFQIQAEKI------LKIEQLAQQYLKSTKKPII 163


>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human
           Tyrosine Phosphatase Receptor, Type R
          Length = 283

 Score = 26.6 bits (57), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 18/37 (48%)

Query: 89  KTEYVNHPLFKLLLEEAESEYGFQSEGPLVLPCRVDV 125
           KT     PL +L+L+  E     Q  GP+V+ C   +
Sbjct: 184 KTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGI 220


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.140    0.429 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,551,698
Number of Sequences: 62578
Number of extensions: 146830
Number of successful extensions: 210
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 208
Number of HSP's gapped (non-prelim): 3
length of query: 172
length of database: 14,973,337
effective HSP length: 92
effective length of query: 80
effective length of database: 9,216,161
effective search space: 737292880
effective search space used: 737292880
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)