Citrus Sinensis ID: 030735


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MSASIFTAPVAGSGYLGLKPTSKALLPVKDSIAWSSKTVSNGSKTRCMKTWNPINNKKFEALSYLPSLSDDSIAKEIDYMLKKGWIPCLEFDEVGYVHRENSKMPGYYDGRYWTMWKLPMFGCNDSSQILNEIQECKKAYPNAYIRCLAFNNQKQGQCMSFLIQKPTTTTST
cccccccccCCccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEcccccCEcccccccccccccCEEEccccccccccHHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEEEEEcccccccc
*****************************************GSKTRCMKTWNPINNKKFEALSYLPSLSDDSIAKEIDYMLKKGWIPCLEFDEVGYVHRENSKMPGYYDGRYWTMWKLPMFGCNDSSQILNEIQECKKAYPNAYIRCLAFNNQKQGQCMSFLI**P******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSASIFTAPVAGSGYLGLKPTSKALLPVKDSIAWSSKTVSNGSKTRCMKTWNPINNKKFEALSYLPSLSDDSIAKEIDYMLKKGWIPCLEFDEVGYVHRENSKMPGYYDGRYWTMWKLPMFGCNDSSQILNEIQECKKAYPNAYIRCLAFNNQKQGQCMSFLIQKPTTTTST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribulose bisphosphate carboxylase small chain 3B, chloroplastic RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.probableP10798
Ribulose bisphosphate carboxylase small chain 2B, chloroplastic RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.probableP10797
Ribulose bisphosphate carboxylase small chain 1B, chloroplastic RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site.probableP10796

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.1.-.-Carbon-carbon lyases.probable
4.1.1.-Carboxy-lyases.probable
4.1.1.39Ribulose-bisphosphate carboxylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WDD, chain S
Confidence level:very confident
Coverage over the Query: 49-169
View the alignment between query and template
View the model in PyMOL