BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030759
         (172 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CNW|A Chain A, Three-Dimensional Structure Of The Protein Xoxi (Q81ay6)
           From Bacillus Cereus. Northeast Structural Genomics
           Consortium Target Bcr196.
 pdb|3CNW|B Chain B, Three-Dimensional Structure Of The Protein Xoxi (Q81ay6)
           From Bacillus Cereus. Northeast Structural Genomics
           Consortium Target Bcr196
          Length = 148

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 15/114 (13%)

Query: 21  TAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTIRWVKEKL 80
           + EQVW  +  F +   WLP + +  L EG     G VR+ A+   D        + E+L
Sbjct: 15  SPEQVWQLIGGFNSLPDWLPYIPSSKLTEG-----GRVRHLANPDGDT-------IIERL 62

Query: 81  ILMDPIQRWLSYEVTDNNLGIKSYVATIKVFPINFDNGMKGCRIEWSYVADPFE 134
            + +  +R+ +Y + +    + +Y++TI+V      N      +EWS    P E
Sbjct: 63  EVFNDKERYYTYSIXNAPFPVTNYLSTIQVKEGTESN---TSLVEWSGTFTPVE 113


>pdb|3F08|A Chain A, Crystal Structure Of The Putative Uncharacterized Protein
           Q6hg14 From Bacilllus Thuringiensis. Northeast
           Structural Genomics Consortium Target Bur153.
 pdb|3F08|B Chain B, Crystal Structure Of The Putative Uncharacterized Protein
           Q6hg14 From Bacilllus Thuringiensis. Northeast
           Structural Genomics Consortium Target Bur153
          Length = 146

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 12/90 (13%)

Query: 21  TAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTIRWVKEKL 80
           + EQVW  +  F +   WLP + +  L EG     G VR+ A+   DG  +      E+L
Sbjct: 13  STEQVWQLIGGFNSLPDWLPYIPSSKLTEG-----GRVRHLAN--PDGETII-----ERL 60

Query: 81  ILMDPIQRWLSYEVTDNNLGIKSYVATIKV 110
            + +  +R+ +Y + +    + +Y++TI+V
Sbjct: 61  EVFNDKERYYTYSIXNAPFPVTNYLSTIQV 90


>pdb|2LE1|A Chain A, Solution Nmr Structure Of Tfu_2981 From Thermobifida
           Fusca, Northeast Structural Genomics Consortium Target
           Tfr85a
          Length = 151

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 52/120 (43%), Gaps = 12/120 (10%)

Query: 12  KESIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEV 71
           + S+E A+  A+ VW  + DF   H+W P +    L    P  PG  R   +        
Sbjct: 5   RRSVEVAAPAAD-VWTLVGDFSAIHRWHPQVSAPTLRGASPHTPGAERVFGAG------- 56

Query: 72  TIRWVKEKLILMDPIQRWLSYEVTDNNLGIKSYVATIKVFPINFDNGMKGCRIEWSYVAD 131
           T   + E+L+  D   R L Y + D    I ++ A ++V P +     + C + W+ + D
Sbjct: 57  TEEELVERLVERDESARRLVYTMPDPPFPITNHRAVLEVVPRD----DRHCTVVWTAMFD 112


>pdb|1LA1|A Chain A, Gro-El Fragment (Apical Domain) Comprising Residues
           188-379
          Length = 192

 Score = 31.6 bits (70), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 112 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 171

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 172 DYDREKL 178


>pdb|1KID|A Chain A, Groel (Hsp60 Class) Fragment (Apical Domain) Comprising
           Residues 191-376, Mutant With Ala 262 Replaced With Leu
           And Ile 267 Replaced With Met
          Length = 203

 Score = 31.2 bits (69), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 126 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 185

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 186 DYDREKL 192


>pdb|3OSX|A Chain A, Crystal Structure Of Apical Domain Of Insecticidal Groel
           From Xenorhapdus Nematophila
          Length = 201

 Score = 29.6 bits (65), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 30/67 (44%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +       +    E T 
Sbjct: 121 TVISEEIGLELEKATLEDLGQAKRVVINKDTTTIIDGVGEEGAIAARVTQIRQQIEESTS 180

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 181 DYDREKL 187


>pdb|1PWO|A Chain A, Crystal Structure Of Phospholipase A2 (Mipla2) From
           Micropechis Ikaheka
 pdb|1PWO|B Chain B, Crystal Structure Of Phospholipase A2 (Mipla2) From
           Micropechis Ikaheka
 pdb|1PWO|C Chain C, Crystal Structure Of Phospholipase A2 (Mipla2) From
           Micropechis Ikaheka
 pdb|1PWO|D Chain D, Crystal Structure Of Phospholipase A2 (Mipla2) From
           Micropechis Ikaheka
          Length = 124

 Score = 29.3 bits (64), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 33/86 (38%), Gaps = 1/86 (1%)

Query: 45  CYLVEGVPGQP-GLVRYCASSKSDGHEVTIRWVKEKLILMDPIQRWLSYEVTDNNLGIKS 103
           CY  +G  G P   +  C  +  + ++   +  + K IL  P     SY+ TD  L    
Sbjct: 27  CYCGKGGSGTPVDELDRCCQTHDNCYDKAEKLPECKGILSGPYVNTYSYDCTDGKLTCND 86

Query: 104 YVATIKVFPINFDNGMKGCRIEWSYV 129
                K+F  N D     C  +  Y+
Sbjct: 87  QKDKCKLFICNCDRTAAMCFAKAPYI 112


>pdb|1SFP|A Chain A, Crystal Structure Of Acidic Seminal Fluid Protein (Asfp)
          At 1.9 A Resolution: A Bovine Polypeptide From The
          Spermadhesin Family
          Length = 114

 Score = 28.5 bits (62), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 26/42 (61%), Gaps = 4/42 (9%)

Query: 41 NLDTCYLVEGVPGQPGLVRYCASS----KSDGHEVTIRWVKE 78
          N ++  +++G+PG P L + C  S    +S G  +T+++++E
Sbjct: 55 NKESLEIIDGLPGSPVLGKICEGSLMDYRSSGSIMTVKYIRE 96


>pdb|3LYL|A Chain A, Structure Of 3-Oxoacyl-Acylcarrier Protein Reductase, Fabg
           From Francisella Tularensis
 pdb|3LYL|B Chain B, Structure Of 3-Oxoacyl-Acylcarrier Protein Reductase, Fabg
           From Francisella Tularensis
 pdb|3LYL|C Chain C, Structure Of 3-Oxoacyl-Acylcarrier Protein Reductase, Fabg
           From Francisella Tularensis
 pdb|3LYL|D Chain D, Structure Of 3-Oxoacyl-Acylcarrier Protein Reductase, Fabg
           From Francisella Tularensis
          Length = 247

 Score = 28.1 bits (61), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 10/67 (14%)

Query: 48  VEGVPGQPGLVRYCAS-------SKSDGHEVTIRWVKEKLILMDPIQRWLSYEVTDNNLG 100
           V G  G PG   YCA+       SKS  +EV  R +   ++    I    + ++TD    
Sbjct: 142 VVGSAGNPGQTNYCAAKAGVIGFSKSLAYEVASRNITVNVVAPGFIATDXTDKLTDEQ-- 199

Query: 101 IKSYVAT 107
            KS++AT
Sbjct: 200 -KSFIAT 205


>pdb|4AAQ|A Chain A, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|B Chain B, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|C Chain C, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|D Chain D, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|E Chain E, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|F Chain F, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|G Chain G, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|H Chain H, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|I Chain I, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|J Chain J, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|K Chain K, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|L Chain L, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|M Chain M, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAQ|N Chain N, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|A Chain A, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|B Chain B, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|C Chain C, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|D Chain D, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|E Chain E, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|F Chain F, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|G Chain G, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|H Chain H, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|I Chain I, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|J Chain J, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|K Chain K, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|L Chain L, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|M Chain M, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAR|N Chain N, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|A Chain A, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|B Chain B, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|C Chain C, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|D Chain D, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|E Chain E, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|F Chain F, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|G Chain G, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|H Chain H, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|I Chain I, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|J Chain J, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|K Chain K, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|L Chain L, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|M Chain M, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAS|N Chain N, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|A Chain A, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|B Chain B, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|C Chain C, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|D Chain D, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|E Chain E, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|F Chain F, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|G Chain G, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|H Chain H, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|I Chain I, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|J Chain J, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|K Chain K, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|L Chain L, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|M Chain M, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AAU|N Chain N, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|A Chain A, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|B Chain B, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|C Chain C, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|D Chain D, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|E Chain E, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|F Chain F, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|G Chain G, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|H Chain H, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|I Chain I, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|J Chain J, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|K Chain K, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|L Chain L, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|M Chain M, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB2|N Chain N, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|A Chain A, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|B Chain B, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|C Chain C, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|D Chain D, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|E Chain E, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|F Chain F, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|G Chain G, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|H Chain H, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|I Chain I, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|J Chain J, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|K Chain K, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|L Chain L, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|M Chain M, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
 pdb|4AB3|N Chain N, Atp-Triggered Molecular Mechanics Of The Chaperonin Groel
          Length = 548

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 299 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 358

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 359 DYDREKL 365


>pdb|1SX3|A Chain A, Groel14-(Atpgammas)14
 pdb|1SX3|B Chain B, Groel14-(Atpgammas)14
 pdb|1SX3|C Chain C, Groel14-(Atpgammas)14
 pdb|1SX3|D Chain D, Groel14-(Atpgammas)14
 pdb|1SX3|E Chain E, Groel14-(Atpgammas)14
 pdb|1SX3|F Chain F, Groel14-(Atpgammas)14
 pdb|1SX3|G Chain G, Groel14-(Atpgammas)14
 pdb|1SX3|H Chain H, Groel14-(Atpgammas)14
 pdb|1SX3|I Chain I, Groel14-(Atpgammas)14
 pdb|1SX3|J Chain J, Groel14-(Atpgammas)14
 pdb|1SX3|K Chain K, Groel14-(Atpgammas)14
 pdb|1SX3|L Chain L, Groel14-(Atpgammas)14
 pdb|1SX3|M Chain M, Groel14-(Atpgammas)14
 pdb|1SX3|N Chain N, Groel14-(Atpgammas)14
          Length = 525

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 298 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 357

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 358 DYDREKL 364


>pdb|1SS8|A Chain A, Groel
 pdb|1SS8|B Chain B, Groel
 pdb|1SS8|C Chain C, Groel
 pdb|1SS8|D Chain D, Groel
 pdb|1SS8|E Chain E, Groel
 pdb|1SS8|F Chain F, Groel
 pdb|1SS8|G Chain G, Groel
          Length = 524

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 298 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 357

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 358 DYDREKL 364


>pdb|1J4Z|A Chain A, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|B Chain B, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|C Chain C, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|D Chain D, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|E Chain E, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|F Chain F, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|G Chain G, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|H Chain H, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|I Chain I, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|J Chain J, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|K Chain K, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|L Chain L, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|M Chain M, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1J4Z|N Chain N, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|O Chain O, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|P Chain P, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|Q Chain Q, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|R Chain R, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|S Chain S, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|T Chain T, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|U Chain U, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|V Chain V, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|W Chain W, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|X Chain X, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|Y Chain Y, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|Z Chain Z, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|1 Chain 1, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
 pdb|1KPO|2 Chain 2, Structural And Mechanistic Basis For Allostery In The
           Bacterial Chaperonin Groel; See Remark 400
          Length = 547

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 298 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 357

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 358 DYDREKL 364


>pdb|1PCQ|A Chain A, Crystal Structure Of Groel-Groes
 pdb|1PCQ|B Chain B, Crystal Structure Of Groel-Groes
 pdb|1PCQ|C Chain C, Crystal Structure Of Groel-Groes
 pdb|1PCQ|D Chain D, Crystal Structure Of Groel-Groes
 pdb|1PCQ|E Chain E, Crystal Structure Of Groel-Groes
 pdb|1PCQ|F Chain F, Crystal Structure Of Groel-Groes
 pdb|1PCQ|G Chain G, Crystal Structure Of Groel-Groes
 pdb|1PCQ|H Chain H, Crystal Structure Of Groel-Groes
 pdb|1PCQ|I Chain I, Crystal Structure Of Groel-Groes
 pdb|1PCQ|J Chain J, Crystal Structure Of Groel-Groes
 pdb|1PCQ|K Chain K, Crystal Structure Of Groel-Groes
 pdb|1PCQ|L Chain L, Crystal Structure Of Groel-Groes
 pdb|1PCQ|M Chain M, Crystal Structure Of Groel-Groes
 pdb|1PCQ|N Chain N, Crystal Structure Of Groel-Groes
 pdb|1PF9|A Chain A, Groel-Groes-Adp
 pdb|1PF9|B Chain B, Groel-Groes-Adp
 pdb|1PF9|C Chain C, Groel-Groes-Adp
 pdb|1PF9|D Chain D, Groel-Groes-Adp
 pdb|1PF9|E Chain E, Groel-Groes-Adp
 pdb|1PF9|F Chain F, Groel-Groes-Adp
 pdb|1PF9|G Chain G, Groel-Groes-Adp
 pdb|1PF9|H Chain H, Groel-Groes-Adp
 pdb|1PF9|I Chain I, Groel-Groes-Adp
 pdb|1PF9|J Chain J, Groel-Groes-Adp
 pdb|1PF9|K Chain K, Groel-Groes-Adp
 pdb|1PF9|L Chain L, Groel-Groes-Adp
 pdb|1PF9|M Chain M, Groel-Groes-Adp
 pdb|1PF9|N Chain N, Groel-Groes-Adp
 pdb|1SVT|A Chain A, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|B Chain B, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|C Chain C, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|D Chain D, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|E Chain E, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|F Chain F, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|G Chain G, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|H Chain H, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|I Chain I, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|J Chain J, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|K Chain K, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|L Chain L, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|M Chain M, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SVT|N Chain N, Crystal Structure Of Groel14-Groes7-(Adp-Alfx)7
 pdb|1SX4|A Chain A, Groel-Groes-Adp7
 pdb|1SX4|B Chain B, Groel-Groes-Adp7
 pdb|1SX4|C Chain C, Groel-Groes-Adp7
 pdb|1SX4|D Chain D, Groel-Groes-Adp7
 pdb|1SX4|E Chain E, Groel-Groes-Adp7
 pdb|1SX4|F Chain F, Groel-Groes-Adp7
 pdb|1SX4|G Chain G, Groel-Groes-Adp7
 pdb|1SX4|H Chain H, Groel-Groes-Adp7
 pdb|1SX4|I Chain I, Groel-Groes-Adp7
 pdb|1SX4|J Chain J, Groel-Groes-Adp7
 pdb|1SX4|K Chain K, Groel-Groes-Adp7
 pdb|1SX4|L Chain L, Groel-Groes-Adp7
 pdb|1SX4|M Chain M, Groel-Groes-Adp7
 pdb|1SX4|N Chain N, Groel-Groes-Adp7
 pdb|2YNJ|A Chain A, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|B Chain B, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|C Chain C, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|D Chain D, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|E Chain E, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|F Chain F, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|G Chain G, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|H Chain H, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|I Chain I, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|J Chain J, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|K Chain K, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|L Chain L, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|M Chain M, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
 pdb|2YNJ|N Chain N, Groel At Sub-Nanometer Resolution By Constrained Single
           Particle Tomography
          Length = 524

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 298 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 357

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 358 DYDREKL 364


>pdb|1KP8|A Chain A, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|B Chain B, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|C Chain C, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|D Chain D, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|E Chain E, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|F Chain F, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|G Chain G, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|H Chain H, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|I Chain I, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|J Chain J, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|K Chain K, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|L Chain L, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|M Chain M, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
 pdb|1KP8|N Chain N, Structural Basis For Groel-Assisted Protein Folding From
           The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A
           Resolution
          Length = 547

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 298 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 357

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 358 DYDREKL 364


>pdb|1AON|A Chain A, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|B Chain B, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|C Chain C, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|D Chain D, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|E Chain E, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|F Chain F, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|G Chain G, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|H Chain H, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|I Chain I, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|J Chain J, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|K Chain K, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|L Chain L, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|M Chain M, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1AON|N Chain N, Crystal Structure Of The Asymmetric Chaperonin Complex
           GroelGROES(ADP)7
 pdb|1GRU|A Chain A, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|B Chain B, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|C Chain C, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|D Chain D, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|E Chain E, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|F Chain F, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|G Chain G, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|H Chain H, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|I Chain I, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|J Chain J, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|K Chain K, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|L Chain L, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|M Chain M, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1GRU|N Chain N, Solution Structure Of Groes-Adp7-Groel-Atp7 Complex By
           Cryo-Em
 pdb|1MNF|A Chain A, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|B Chain B, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|C Chain C, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|D Chain D, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|E Chain E, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|F Chain F, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|G Chain G, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|H Chain H, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|I Chain I, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|J Chain J, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|K Chain K, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|L Chain L, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|M Chain M, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1MNF|N Chain N, Domain Motions In Groel Upon Binding Of An Oligopeptide
 pdb|1XCK|A Chain A, Crystal Structure Of Apo Groel
 pdb|1XCK|B Chain B, Crystal Structure Of Apo Groel
 pdb|1XCK|C Chain C, Crystal Structure Of Apo Groel
 pdb|1XCK|D Chain D, Crystal Structure Of Apo Groel
 pdb|1XCK|E Chain E, Crystal Structure Of Apo Groel
 pdb|1XCK|F Chain F, Crystal Structure Of Apo Groel
 pdb|1XCK|G Chain G, Crystal Structure Of Apo Groel
 pdb|1XCK|H Chain H, Crystal Structure Of Apo Groel
 pdb|1XCK|I Chain I, Crystal Structure Of Apo Groel
 pdb|1XCK|J Chain J, Crystal Structure Of Apo Groel
 pdb|1XCK|K Chain K, Crystal Structure Of Apo Groel
 pdb|1XCK|L Chain L, Crystal Structure Of Apo Groel
 pdb|1XCK|M Chain M, Crystal Structure Of Apo Groel
 pdb|1XCK|N Chain N, Crystal Structure Of Apo Groel
 pdb|2C7C|A Chain A, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|B Chain B, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|C Chain C, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|D Chain D, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|E Chain E, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|F Chain F, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|G Chain G, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|H Chain H, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|I Chain I, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|J Chain J, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|K Chain K, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|L Chain L, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|M Chain M, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7C|N Chain N, Fitted Coordinates For Groel-Atp7-Groes Cryo-Em Complex
           (Emd-1180)
 pdb|2C7D|A Chain A, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|B Chain B, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|C Chain C, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|D Chain D, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|E Chain E, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|F Chain F, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|G Chain G, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|H Chain H, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|I Chain I, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|J Chain J, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|K Chain K, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|L Chain L, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|M Chain M, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2C7D|N Chain N, Fitted Coordinates For Groel-Adp7-Groes Cryo-Em Complex
           (Emd-1181)
 pdb|2CGT|A Chain A, Groel-Adp-Gp31 Complex
 pdb|2CGT|B Chain B, Groel-Adp-Gp31 Complex
 pdb|2CGT|C Chain C, Groel-Adp-Gp31 Complex
 pdb|2CGT|D Chain D, Groel-Adp-Gp31 Complex
 pdb|2CGT|E Chain E, Groel-Adp-Gp31 Complex
 pdb|2CGT|F Chain F, Groel-Adp-Gp31 Complex
 pdb|2CGT|G Chain G, Groel-Adp-Gp31 Complex
 pdb|2CGT|H Chain H, Groel-Adp-Gp31 Complex
 pdb|2CGT|I Chain I, Groel-Adp-Gp31 Complex
 pdb|2CGT|J Chain J, Groel-Adp-Gp31 Complex
 pdb|2CGT|K Chain K, Groel-Adp-Gp31 Complex
 pdb|2CGT|L Chain L, Groel-Adp-Gp31 Complex
 pdb|2CGT|M Chain M, Groel-Adp-Gp31 Complex
 pdb|2CGT|N Chain N, Groel-Adp-Gp31 Complex
 pdb|2NWC|A Chain A, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|B Chain B, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|C Chain C, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|D Chain D, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|E Chain E, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|F Chain F, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|G Chain G, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|H Chain H, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|I Chain I, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|J Chain J, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|K Chain K, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|L Chain L, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|M Chain M, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|2NWC|N Chain N, A 3.02 Angstrom Crystal Structure Of Wild-Type Apo Groel
           In A Monoclinic Space Group
 pdb|3E76|A Chain A, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|B Chain B, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|C Chain C, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|D Chain D, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|E Chain E, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|F Chain F, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|G Chain G, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|H Chain H, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|I Chain I, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|J Chain J, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|K Chain K, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|L Chain L, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|M Chain M, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
 pdb|3E76|N Chain N, Crystal Structure Of Wild-Type Groel With Bound Thallium
           Ions
          Length = 547

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 298 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 357

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 358 DYDREKL 364


>pdb|2YEY|A Chain A, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|B Chain B, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|C Chain C, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|D Chain D, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|E Chain E, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|F Chain F, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|G Chain G, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|H Chain H, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|I Chain I, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|J Chain J, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|K Chain K, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|L Chain L, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|M Chain M, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
 pdb|2YEY|N Chain N, Crystal Structure Of The Allosteric-Defective Chaperonin
           Groel E434k Mutant
          Length = 524

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 298 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 357

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 358 DYDREKL 364


>pdb|3CAU|A Chain A, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|B Chain B, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|C Chain C, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|D Chain D, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|E Chain E, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|F Chain F, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|G Chain G, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|H Chain H, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|I Chain I, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|J Chain J, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|K Chain K, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|L Chain L, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|M Chain M, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
 pdb|3CAU|N Chain N, D7 Symmetrized Structure Of Unliganded Groel At 4.2
           Angstrom Resolution By Cryoem
          Length = 526

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 298 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 357

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 358 DYDREKL 364


>pdb|3C9V|A Chain A, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|B Chain B, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|C Chain C, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|D Chain D, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|E Chain E, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|F Chain F, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|G Chain G, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|H Chain H, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|I Chain I, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|J Chain J, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|K Chain K, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|L Chain L, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|M Chain M, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
 pdb|3C9V|N Chain N, C7 Symmetrized Structure Of Unliganded Groel At 4.7
           Angstrom Resolution From Cryoem
          Length = 526

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 298 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 357

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 358 DYDREKL 364


>pdb|2EU1|A Chain A, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|B Chain B, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|C Chain C, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|D Chain D, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|E Chain E, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|F Chain F, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|G Chain G, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|H Chain H, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|I Chain I, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|J Chain J, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|K Chain K, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|L Chain L, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|M Chain M, Crystal Structure Of The Chaperonin Groel-E461k
 pdb|2EU1|N Chain N, Crystal Structure Of The Chaperonin Groel-E461k
          Length = 548

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 299 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 358

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 359 DYDREKL 365


>pdb|1GR5|A Chain A, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|B Chain B, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|C Chain C, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|D Chain D, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|E Chain E, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|F Chain F, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|G Chain G, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|H Chain H, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|I Chain I, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|J Chain J, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|K Chain K, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|L Chain L, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|M Chain M, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|1GR5|N Chain N, Solution Structure Of Apo Groel By Cryo-Electron
           Microscopy
 pdb|2C7E|A Chain A, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|B Chain B, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|C Chain C, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|D Chain D, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|E Chain E, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|F Chain F, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|G Chain G, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|H Chain H, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|I Chain I, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|J Chain J, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|K Chain K, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|L Chain L, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|M Chain M, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
 pdb|2C7E|N Chain N, Revised Atomic Structure Fitting Into A Groel(D398a)-Atp7
           Cryo-Em Map (Emd 1047)
          Length = 547

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 298 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 357

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 358 DYDREKL 364


>pdb|1GRL|A Chain A, The Crystal Structure Of The Bacterial Chaperonin Groel At
           2.8 Angstroms
 pdb|1GRL|B Chain B, The Crystal Structure Of The Bacterial Chaperonin Groel At
           2.8 Angstroms
 pdb|1GRL|C Chain C, The Crystal Structure Of The Bacterial Chaperonin Groel At
           2.8 Angstroms
 pdb|1GRL|D Chain D, The Crystal Structure Of The Bacterial Chaperonin Groel At
           2.8 Angstroms
 pdb|1GRL|E Chain E, The Crystal Structure Of The Bacterial Chaperonin Groel At
           2.8 Angstroms
 pdb|1GRL|F Chain F, The Crystal Structure Of The Bacterial Chaperonin Groel At
           2.8 Angstroms
 pdb|1GRL|G Chain G, The Crystal Structure Of The Bacterial Chaperonin Groel At
           2.8 Angstroms
          Length = 548

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 299 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 358

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 359 DYDREKL 365


>pdb|1OEL|A Chain A, Conformational Variability In The Refined Structure Of The
           Chaperonin Groel At 2.8 Angstrom Resolution
 pdb|1OEL|B Chain B, Conformational Variability In The Refined Structure Of The
           Chaperonin Groel At 2.8 Angstrom Resolution
 pdb|1OEL|C Chain C, Conformational Variability In The Refined Structure Of The
           Chaperonin Groel At 2.8 Angstrom Resolution
 pdb|1OEL|D Chain D, Conformational Variability In The Refined Structure Of The
           Chaperonin Groel At 2.8 Angstrom Resolution
 pdb|1OEL|E Chain E, Conformational Variability In The Refined Structure Of The
           Chaperonin Groel At 2.8 Angstrom Resolution
 pdb|1OEL|F Chain F, Conformational Variability In The Refined Structure Of The
           Chaperonin Groel At 2.8 Angstrom Resolution
 pdb|1OEL|G Chain G, Conformational Variability In The Refined Structure Of The
           Chaperonin Groel At 2.8 Angstrom Resolution
          Length = 547

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%)

Query: 14  SIESASITAEQVWACLEDFCNAHKWLPNLDTCYLVEGVPGQPGLVRYCASSKSDGHEVTI 73
           ++ S  I  E   A LED   A + + N DT  +++GV  +  +    A  +    E T 
Sbjct: 298 TVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATS 357

Query: 74  RWVKEKL 80
            + +EKL
Sbjct: 358 DYDREKL 364


>pdb|1HA6|A Chain A, Nmr Solution Structure Of Murine Ccl20MIP-3a Chemokine
          Length = 70

 Score = 26.9 bits (58), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 27/66 (40%), Gaps = 4/66 (6%)

Query: 41  NLDTC--YLVEGVPGQP--GLVRYCASSKSDGHEVTIRWVKEKLILMDPIQRWLSYEVTD 96
           N D C  Y+   +P +   G  R  A    D + +     K K +  DP Q W+   V  
Sbjct: 3   NYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNL 62

Query: 97  NNLGIK 102
            +L +K
Sbjct: 63  LSLRVK 68


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.133    0.424 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,568,502
Number of Sequences: 62578
Number of extensions: 228607
Number of successful extensions: 469
Number of sequences better than 100.0: 26
Number of HSP's better than 100.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 447
Number of HSP's gapped (non-prelim): 26
length of query: 172
length of database: 14,973,337
effective HSP length: 92
effective length of query: 80
effective length of database: 9,216,161
effective search space: 737292880
effective search space used: 737292880
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)