Citrus Sinensis ID: 030761

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MAGVVATAEACDSNAALLASGDLRVLQPVFQIYGQCRSFSGPVVTLKVFEDNVLVRELLETRGEGKVLVIDGGGSMRCALVGGNLGQLAHNNGWSGIVVNGCIRDVDEINGCGIGVRALGSHPLKSNKKGHGDKHVPVYIAGVYIAGSFIRDGEWLYADSDGILVSKSELSI
ccccccccccccccccccccccCEEcccccEEcccccCEEEEEEEEEEcccHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHHcccCEEEEEcccccHHHHccccccEEEEEEccccccccccccccccEEEccEEEcccccccccEEEEccccEEEEcccccc
**GVVATAEACDSNAALLASGDLRVLQPVFQIYGQCRSFSGPVVTLKVFEDNVLVRELLETRGEGKVLVIDGGGSMRCALVGGNLGQLAHNNGWSGIVVNGCIRDVDEINGCGIGVRALGSHPLKSNKKGHGDKHVPVYIAGVYIAGSFIRDGEWLYADSDGILVSKSELSI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGVVATAEACDSNAALLASGDLRVLQPVFQIYGQCRSFSGPVVTLKVFEDNVLVRELLETRGEGKVLVIDGGGSMRCALVGGNLGQLAHNNGWSGIVVNGCIRDVDEINGCGIGVRALGSHPLKSNKKGHGDKHVPVYIAGVYIAGSFIRDGEWLYADSDGILVSKSELSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Regulator of ribonuclease-like protein 3 Potential inhibitor of endonuclease activity of RNase proteins. It probably does not have any methyltransferase activity.confidentQ9FH13
Putative regulator of ribonuclease activity probableQ47BF5
Putative regulator of ribonuclease activity probableQ13X79

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q5X, chain A
Confidence level:very confident
Coverage over the Query: 4-172
View the alignment between query and template
View the model in PyMOL