Query         030779
Match_columns 171
No_of_seqs    150 out of 441
Neff          4.8 
Searched_HMMs 46136
Date          Fri Mar 29 04:27:09 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030779.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030779hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3173 Predicted Zn-finger pr 100.0 3.5E-47 7.6E-52  307.5  10.5  162    1-171     1-167 (167)
  2 smart00154 ZnF_AN1 AN1-like Zi  99.6 1.7E-15 3.8E-20   96.3   2.3   38  112-149     1-39  (39)
  3 PF01754 zf-A20:  A20-like zinc  99.5 2.4E-15 5.2E-20   87.7   2.3   25   15-39      1-25  (25)
  4 smart00259 ZnF_A20 A20-like zi  99.5   1E-14 2.2E-19   85.7   1.1   25   15-39      1-26  (26)
  5 PF01428 zf-AN1:  AN1-like Zinc  99.1 3.6E-11 7.8E-16   77.4   1.6   38  112-150     1-41  (43)
  6 COG3582 Predicted nucleic acid  96.8 0.00066 1.4E-08   55.4   1.6   38  111-149    99-137 (162)
  7 KOG3183 Predicted Zn-finger pr  96.5  0.0011 2.4E-08   57.2   1.1   40  110-150     9-51  (250)
  8 PF01363 FYVE:  FYVE zinc finge  94.3   0.024 5.3E-07   38.6   1.6   29  108-136     8-39  (69)
  9 KOG3183 Predicted Zn-finger pr  93.3   0.019 4.1E-07   49.7  -0.6   41  105-145    94-138 (250)
 10 cd00065 FYVE FYVE domain; Zinc  92.9   0.045 9.8E-07   35.8   0.9   27  110-136     3-32  (57)
 11 smart00064 FYVE Protein presen  92.6   0.067 1.4E-06   36.3   1.4   29  109-137    10-41  (68)
 12 KOG1818 Membrane trafficking a  89.5    0.13 2.8E-06   49.9   0.6   45  108-152   164-222 (634)
 13 PF10571 UPF0547:  Uncharacteri  87.7    0.27 5.9E-06   28.7   0.9   23  110-132     1-24  (26)
 14 PF00130 C1_1:  Phorbol esters/  84.3    0.64 1.4E-05   29.9   1.5   24  108-131    10-37  (53)
 15 PF15135 UPF0515:  Uncharacteri  81.6    0.81 1.8E-05   40.2   1.5   30  105-134   128-167 (278)
 16 PF02148 zf-UBP:  Zn-finger in   68.2       3 6.5E-05   28.2   1.3   23  112-135     1-24  (63)
 17 PF14471 DUF4428:  Domain of un  66.4       2 4.3E-05   28.6   0.1   22  111-132     1-30  (51)
 18 KOG1729 FYVE finger containing  59.6     2.6 5.6E-05   37.3  -0.4   33  107-140   166-202 (288)
 19 PF13978 DUF4223:  Protein of u  58.4     4.7  0.0001   27.6   0.8   18  132-149    19-36  (56)
 20 smart00109 C1 Protein kinase C  58.3     5.5 0.00012   24.3   1.1   24  108-131    10-36  (49)
 21 cd00029 C1 Protein kinase C co  58.1     5.5 0.00012   24.6   1.0   24  108-131    10-37  (50)
 22 PHA02768 hypothetical protein;  57.5     4.3 9.3E-05   27.7   0.5   16  120-135     2-18  (55)
 23 KOG1819 FYVE finger-containing  55.8     6.4 0.00014   38.3   1.5   30  108-137   900-932 (990)
 24 PF01194 RNA_pol_N:  RNA polyme  55.0     6.4 0.00014   27.4   1.0   13  109-121     4-16  (60)
 25 COG1996 RPC10 DNA-directed RNA  54.3     5.3 0.00011   26.8   0.5   22  109-130     6-32  (49)
 26 PF08882 Acetone_carb_G:  Aceto  52.9     6.9 0.00015   30.4   1.0   33  113-147    16-48  (112)
 27 PF07649 C1_3:  C1-like domain;  51.1     6.9 0.00015   22.7   0.6   22  111-132     2-25  (30)
 28 KOG1812 Predicted E3 ubiquitin  50.3     8.6 0.00019   35.1   1.4   31  107-137   304-338 (384)
 29 PRK04016 DNA-directed RNA poly  50.3     5.9 0.00013   27.8   0.3   14  108-121     3-16  (62)
 30 PLN00032 DNA-directed RNA poly  48.9     6.7 0.00015   28.2   0.4   13  109-121     4-16  (71)
 31 PF05207 zf-CSL:  CSL zinc fing  48.4       8 0.00017   25.9   0.7   13  121-133    16-28  (55)
 32 PF03107 C1_2:  C1 domain;  Int  46.0      15 0.00032   21.5   1.5   20  111-130     2-23  (30)
 33 smart00290 ZnF_UBP Ubiquitin C  45.7     7.5 0.00016   24.6   0.2   24  111-136     1-25  (50)
 34 PTZ00303 phosphatidylinositol   44.5      12 0.00026   38.3   1.4   27  110-136   461-495 (1374)
 35 PF02318 FYVE_2:  FYVE-type zin  42.9      17 0.00038   27.4   1.9   31  109-139    54-88  (118)
 36 PF02928 zf-C5HC2:  C5HC2 zinc   42.4      12 0.00027   24.7   0.8   26  112-137     1-28  (54)
 37 KOG3497 DNA-directed RNA polym  42.2     8.6 0.00019   27.2   0.1   13  109-121     4-16  (69)
 38 PF03604 DNA_RNApol_7kD:  DNA d  42.2      12 0.00025   22.8   0.6   18  112-129     3-24  (32)
 39 PRK08402 replication factor A;  42.1      12 0.00026   33.9   1.0   28  110-138   213-245 (355)
 40 KOG2807 RNA polymerase II tran  42.1      16 0.00034   33.6   1.7   29  107-135   328-358 (378)
 41 smart00659 RPOLCX RNA polymera  41.7      13 0.00028   24.0   0.8   20  110-129     3-26  (44)
 42 PF07975 C1_4:  TFIIH C1-like d  40.0      12 0.00026   25.1   0.5   34  112-145     2-47  (51)
 43 COG1571 Predicted DNA-binding   39.9      13 0.00028   34.8   0.9   26  109-134   350-379 (421)
 44 PHA00626 hypothetical protein   39.7      15 0.00033   25.5   0.9   22  110-133    12-34  (59)
 45 cd04476 RPA1_DBD_C RPA1_DBD_C:  38.8      14  0.0003   29.0   0.8   31  109-139    34-69  (166)
 46 PF13240 zinc_ribbon_2:  zinc-r  38.7      17 0.00037   20.3   0.9   20  111-130     1-21  (23)
 47 COG1644 RPB10 DNA-directed RNA  38.5      10 0.00023   26.7   0.0   13  109-121     4-16  (63)
 48 PF11781 RRN7:  RNA polymerase   37.0      16 0.00034   22.6   0.7   22  110-131     9-34  (36)
 49 PF13717 zinc_ribbon_4:  zinc-r  34.7      21 0.00045   21.9   0.9    9  124-132    26-35  (36)
 50 KOG1842 FYVE finger-containing  34.0      10 0.00022   35.9  -0.7   25  110-134   181-208 (505)
 51 PF10367 Vps39_2:  Vacuolar sor  32.5      31 0.00066   24.4   1.7   24  109-132    78-102 (109)
 52 PF13842 Tnp_zf-ribbon_2:  DDE_  32.5      35 0.00075   20.5   1.6   26  111-136     2-30  (32)
 53 PF09723 Zn-ribbon_8:  Zinc rib  32.3      27 0.00059   21.9   1.2   20  121-140     3-23  (42)
 54 PF15549 PGC7_Stella:  PGC7/Ste  31.8      25 0.00054   28.9   1.2   19  123-143   123-141 (160)
 55 smart00647 IBR In Between Ring  31.3      32  0.0007   22.1   1.5   18  122-139    39-57  (64)
 56 PF13248 zf-ribbon_3:  zinc-rib  31.2      28  0.0006   19.7   1.0   21  110-130     3-24  (26)
 57 PRK04136 rpl40e 50S ribosomal   30.8      25 0.00055   23.5   0.9   23  108-130    13-36  (48)
 58 PF04438 zf-HIT:  HIT zinc fing  29.9      18 0.00039   21.5   0.1   23  110-135     3-26  (30)
 59 PRK00398 rpoP DNA-directed RNA  29.4      28 0.00061   21.9   0.9   28  110-137     4-36  (46)
 60 PF06750 DiS_P_DiS:  Bacterial   29.1      32 0.00069   25.2   1.3   14  109-122    33-46  (92)
 61 PRK07218 replication factor A;  29.1      25 0.00054   32.7   0.9   21  109-131   297-318 (423)
 62 PF08073 CHDNT:  CHDNT (NUC034)  28.6      22 0.00049   24.3   0.4   20  150-169    21-40  (55)
 63 PF01485 IBR:  IBR domain;  Int  28.1      25 0.00055   22.5   0.6   16  124-139    41-57  (64)
 64 PF10122 Mu-like_Com:  Mu-like   27.0      24 0.00051   23.9   0.2   24  109-132     4-34  (51)
 65 PF08600 Rsm1:  Rsm1-like;  Int  26.6      25 0.00053   25.7   0.3   18  109-126    19-36  (91)
 66 PF00096 zf-C2H2:  Zinc finger,  26.6      28  0.0006   18.3   0.5    9  124-132     1-10  (23)
 67 KOG0193 Serine/threonine prote  26.0      24 0.00052   34.8   0.2   50  110-164   190-243 (678)
 68 PF14835 zf-RING_6:  zf-RING of  25.5      40 0.00086   23.9   1.2   26  110-135     8-33  (65)
 69 PF00412 LIM:  LIM domain;  Int  25.5      29 0.00063   22.0   0.5   27  110-136    27-53  (58)
 70 PF14634 zf-RING_5:  zinc-RING   25.3      40 0.00088   20.9   1.1   29  111-139     1-31  (44)
 71 KOG3507 DNA-directed RNA polym  24.5      34 0.00074   24.0   0.7   23  108-130    19-45  (62)
 72 PRK12366 replication factor A;  24.5      32 0.00068   33.4   0.7   29  109-138   532-563 (637)
 73 COG2888 Predicted Zn-ribbon RN  23.8      28 0.00061   24.4   0.2   21  108-130    37-58  (61)
 74 KOG1074 Transcriptional repres  23.1      42 0.00091   34.3   1.3   45  104-148   600-672 (958)
 75 smart00396 ZnF_UBR1 Putative z  22.9      46 0.00099   23.2   1.1   14  123-136    50-70  (71)
 76 PTZ00218 40S ribosomal protein  22.0      54  0.0012   22.4   1.3   13   31-43     34-46  (54)
 77 smart00834 CxxC_CXXC_SSSS Puta  21.1      47   0.001   19.8   0.8   12  122-133     4-16  (41)
 78 PF13923 zf-C3HC4_2:  Zinc fing  20.8      46 0.00099   20.0   0.7   23  112-134     1-23  (39)
 79 COG3357 Predicted transcriptio  20.2      37  0.0008   25.8   0.2   13  122-134    57-70  (97)
 80 PF07282 OrfB_Zn_ribbon:  Putat  20.2      70  0.0015   21.4   1.5   23  109-131    28-55  (69)
 81 PF12662 cEGF:  Complement Clr-  20.1      98  0.0021   17.6   1.9   20  123-145     1-20  (24)
 82 PF11722 zf-TRM13_CCCH:  CCCH z  20.1      44 0.00096   20.1   0.5   11  127-137    20-30  (31)

No 1  
>KOG3173 consensus Predicted Zn-finger protein [General function prediction only]
Probab=100.00  E-value=3.5e-47  Score=307.54  Aligned_cols=162  Identities=45%  Similarity=0.805  Sum_probs=107.8

Q ss_pred             CCCccccCCCCC-CCccchhcCCCCCCccccCCchhHHHHHHHHHHHHH-hhhhccccccccCCCCCCCCCCcccCCccc
Q 030779            1 MESHDETGCQAP-EGPILCVNNCGFFGSAATMNMCSKCHKAMILNQEQA-QLAASSIGSIVHGSSGGTGKEPIVAGSVDL   78 (171)
Q Consensus         1 M~~~~~~~~q~p-~~p~lC~n~CGFfGs~at~n~CSkCyr~~~~~~~~~-~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~   78 (171)
                      |+ ++....+.+ ..++||+|||||||+|+|+||||+||++++.++++. ..+...+...+.+ +   ...+    ..+.
T Consensus         1 M~-~e~~~~~~~~~~~~lc~~gCGf~G~p~~~n~CSkC~~e~~~~~~~~~~~~~~~~~~~~~~-~---~s~~----~~~~   71 (167)
T KOG3173|consen    1 MA-SETNGSQTPPSQDLLCVNGCGFYGSPATENLCSKCYRDHLLRQQQKQARASPPVESSLSS-P---RSVP----SRDP   71 (167)
T ss_pred             Cc-ccccCCCCCCccccccccCccccCChhhccHHHHHHHHHHHHhhhccccccCcccccccC-c---cccC----cccc
Confidence            55 444444432 346999999999999999999999999999887765 2222211110000 0   0000    0000


Q ss_pred             cCCccccccc-ccCCC--CCCCCCCCCCCCCCCCCccccccccccccceeeecCccccCCCCCCCCCCCCccchHHHHHH
Q 030779           79 QVGPVEIKKF-SMEPS--SGSSFGFAGVKAKEGPKRCTTCNKRVGLTGFNCRCGNLFCAVHRYSDKHGCPFDYRTAAREA  155 (171)
Q Consensus        79 ~~~~~~~~~~-~~~~~--~~~~~~~~~~~~~~~~~rC~~C~kkvgl~gf~CrCg~~FC~~HRy~e~H~C~fDyk~~~r~~  155 (171)
                      .....+.... +...+  ..+............++||..|+|||||+||.||||++||+.|||||.|+|+||||.+||+.
T Consensus        72 ~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~rC~~C~kk~gltgf~CrCG~~fC~~HRy~e~H~C~fDyK~~gr~~  151 (167)
T KOG3173|consen   72 PAVSLESTTESELKLVSDTPSTEEEDEESKPKKKKRCFKCRKKVGLTGFKCRCGNTFCGTHRYPEQHDCSFDYKQAGREK  151 (167)
T ss_pred             ccccccccccccccccccCCcccccccccccccchhhhhhhhhhcccccccccCCcccccccCCccccccccHHHHHHHH
Confidence            0000000000 00000  00011112233445688999999999999999999999999999999999999999999999


Q ss_pred             HHHhCCcccccccccC
Q 030779          156 IAKANPVVKAEKLDKI  171 (171)
Q Consensus       156 i~k~Np~v~~~Ki~KI  171 (171)
                      |+++||+|+++||+||
T Consensus       152 i~k~nP~v~a~k~~ki  167 (167)
T KOG3173|consen  152 IAKANPVVKADKLQKI  167 (167)
T ss_pred             HHHhCCeeeccccccC
Confidence            9999999999999998


No 2  
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=99.55  E-value=1.7e-15  Score=96.27  Aligned_cols=38  Identities=63%  Similarity=1.456  Sum_probs=36.9

Q ss_pred             cccccccccccceeee-cCccccCCCCCCCCCCCCccch
Q 030779          112 CTTCNKRVGLTGFNCR-CGNLFCAVHRYSDKHGCPFDYR  149 (171)
Q Consensus       112 C~~C~kkvgl~gf~Cr-Cg~~FC~~HRy~e~H~C~fDyk  149 (171)
                      |+.|+++++|++|+|+ |+++||..|||||.|+|++|||
T Consensus         1 C~~C~~~~~l~~f~C~~C~~~FC~~HR~~e~H~C~~~~k   39 (39)
T smart00154        1 CHFCRKKVGLTGFKCRHCGNLFCGEHRLPEDHDCPGDYK   39 (39)
T ss_pred             CcccCCcccccCeECCccCCccccccCCccccCCccccC
Confidence            7899999999999999 9999999999999999999996


No 3  
>PF01754 zf-A20:  A20-like zinc finger;  InterPro: IPR002653 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in A20. A20 is an inhibitor of cell death that inhibits NF-kappaB activation via the tumour necrosis factor receptor associated factor pathway []. The zinc finger domains appear to mediate self-association in A20. These fingers also mediate IL-1-induced NF-kappa B activation. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 2FIF_F 2FID_B 2C7N_C 2C7M_A 2L00_A 2KZY_A 2EQG_A 2EQE_A 3OJ3_J 3OJ4_C ....
Probab=99.54  E-value=2.4e-15  Score=87.66  Aligned_cols=25  Identities=60%  Similarity=1.327  Sum_probs=20.8

Q ss_pred             ccchhcCCCCCCccccCCchhHHHH
Q 030779           15 PILCVNNCGFFGSAATMNMCSKCHK   39 (171)
Q Consensus        15 p~lC~n~CGFfGs~at~n~CSkCyr   39 (171)
                      |+||++|||||||++|+||||+|||
T Consensus         1 ~~~C~~gCgf~Gs~~~~~~Cs~C~~   25 (25)
T PF01754_consen    1 PSLCANGCGFYGSPATNGLCSKCYR   25 (25)
T ss_dssp             SSB-TTTSSSB-BGGGTTS-HHHHH
T ss_pred             CCcccCCCCCcccccccCcchhhcC
Confidence            5799999999999999999999997


No 4  
>smart00259 ZnF_A20 A20-like zinc fingers. A20- (an inhibitor of cell death)-like zinc fingers. The zinc finger mediates self-association in A20. These fingers also mediate IL-1-induced NF-kappaB activation.
Probab=99.47  E-value=1e-14  Score=85.73  Aligned_cols=25  Identities=60%  Similarity=1.278  Sum_probs=23.4

Q ss_pred             ccchh-cCCCCCCccccCCchhHHHH
Q 030779           15 PILCV-NNCGFFGSAATMNMCSKCHK   39 (171)
Q Consensus        15 p~lC~-n~CGFfGs~at~n~CSkCyr   39 (171)
                      |++|+ +||||||||+|+||||||||
T Consensus         1 ~~~C~~~~CgF~G~~~t~~~CskCy~   26 (26)
T smart00259        1 PIKCRRPGCGFFGNPATEGLCSKCFK   26 (26)
T ss_pred             CCccccCCCCCcCChhhcccCHhhcC
Confidence            46899 99999999999999999996


No 5  
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=99.08  E-value=3.6e-11  Score=77.36  Aligned_cols=38  Identities=34%  Similarity=0.866  Sum_probs=28.1

Q ss_pred             ccc--ccccccccceeee-cCccccCCCCCCCCCCCCccchH
Q 030779          112 CTT--CNKRVGLTGFNCR-CGNLFCAVHRYSDKHGCPFDYRT  150 (171)
Q Consensus       112 C~~--C~kkvgl~gf~Cr-Cg~~FC~~HRy~e~H~C~fDyk~  150 (171)
                      |..  |++++. ++|.|+ |+..||..||||+.|+|+++++.
T Consensus         1 C~~~~C~~~~~-~~~~C~~C~~~FC~~Hr~~e~H~C~~~~~~   41 (43)
T PF01428_consen    1 CSFPGCKKKDF-LPFKCKHCGKSFCLKHRLPEDHNCSKLQKK   41 (43)
T ss_dssp             -SSTTT--BCT-SHEE-TTTS-EE-TTTHSTTTCT-SSTTSC
T ss_pred             CccCcCcCccC-CCeECCCCCcccCccccCccccCCcchhhc
Confidence            455  998887 799999 99999999999999999999874


No 6  
>COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger [General function prediction only]
Probab=96.76  E-value=0.00066  Score=55.43  Aligned_cols=38  Identities=29%  Similarity=0.491  Sum_probs=30.2

Q ss_pred             ccccccccccccceeee-cCccccCCCCCCCCCCCCccch
Q 030779          111 RCTTCNKRVGLTGFNCR-CGNLFCAVHRYSDKHGCPFDYR  149 (171)
Q Consensus       111 rC~~C~kkvgl~gf~Cr-Cg~~FC~~HRy~e~H~C~fDyk  149 (171)
                      +|..|++..+|. ++|- |++.||+.||+++.|+|.+...
T Consensus        99 ~~~~~g~~s~l~-~~c~~c~g~fc~~h~lp~nhdc~~L~s  137 (162)
T COG3582          99 TPQCTGKGSTLA-GKCNYCTGYFCAEHRLPENHDCNGLGS  137 (162)
T ss_pred             cceeccCCcccc-ccccCCCCcceeceecccccccccHHH
Confidence            344555555554 8898 9999999999999999998854


No 7  
>KOG3183 consensus Predicted Zn-finger protein [General function prediction only]
Probab=96.47  E-value=0.0011  Score=57.25  Aligned_cols=40  Identities=35%  Similarity=0.945  Sum_probs=35.1

Q ss_pred             Cccc--cccccccccceeee-cCccccCCCCCCCCCCCCccchH
Q 030779          110 KRCT--TCNKRVGLTGFNCR-CGNLFCAVHRYSDKHGCPFDYRT  150 (171)
Q Consensus       110 ~rC~--~C~kkvgl~gf~Cr-Cg~~FC~~HRy~e~H~C~fDyk~  150 (171)
                      ..|.  .|+ .+.++.|+|- |+.+||..||-.+.|+|.+.|..
T Consensus         9 kHCs~~~Ck-qlDFLPf~Cd~C~~~FC~eHrsye~H~Cp~~~~~   51 (250)
T KOG3183|consen    9 KHCSVPYCK-QLDFLPFKCDGCSGIFCLEHRSYESHHCPKGLRI   51 (250)
T ss_pred             cccCcchhh-hccccceeeCCccchhhhccchHhhcCCCccccc
Confidence            4676  787 6788999999 99999999999999999998763


No 8  
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=94.32  E-value=0.024  Score=38.62  Aligned_cols=29  Identities=31%  Similarity=0.887  Sum_probs=17.7

Q ss_pred             CCCcccccccccccc--ceeee-cCccccCCC
Q 030779          108 GPKRCTTCNKRVGLT--GFNCR-CGNLFCAVH  136 (171)
Q Consensus       108 ~~~rC~~C~kkvgl~--gf~Cr-Cg~~FC~~H  136 (171)
                      ....|..|+++.+|+  -..|| ||.+||+.+
T Consensus         8 ~~~~C~~C~~~F~~~~rrhhCr~CG~~vC~~C   39 (69)
T PF01363_consen    8 EASNCMICGKKFSLFRRRHHCRNCGRVVCSSC   39 (69)
T ss_dssp             G-SB-TTT--B-BSSS-EEE-TTT--EEECCC
T ss_pred             CCCcCcCcCCcCCCceeeEccCCCCCEECCch
Confidence            457899999999997  49999 999999764


No 9  
>KOG3183 consensus Predicted Zn-finger protein [General function prediction only]
Probab=93.28  E-value=0.019  Score=49.74  Aligned_cols=41  Identities=34%  Similarity=0.782  Sum_probs=34.8

Q ss_pred             CCCCCCccc--ccccccccc-ceeee-cCccccCCCCCCCCCCCC
Q 030779          105 AKEGPKRCT--TCNKRVGLT-GFNCR-CGNLFCAVHRYSDKHGCP  145 (171)
Q Consensus       105 ~~~~~~rC~--~C~kkvgl~-gf~Cr-Cg~~FC~~HRy~e~H~C~  145 (171)
                      .+...++|.  .|++++-|. .+.|+ ||..||-+||++-.|.|.
T Consensus        94 ~k~~t~kc~~~~c~k~~~~~~~~~c~~c~~~~c~khr~~~dhsc~  138 (250)
T KOG3183|consen   94 RKVFTNKCPVPRCKKTLTLANKITCSKCGRNFCLKHRHPLDHSCN  138 (250)
T ss_pred             cccccccCCchhhHHHHHHHHhhhhHhhcchhhhhccCCCCchhh
Confidence            444567786  789888775 69999 999999999999999998


No 10 
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=92.90  E-value=0.045  Score=35.76  Aligned_cols=27  Identities=41%  Similarity=1.030  Sum_probs=23.7

Q ss_pred             Ccccccccccccc--ceeee-cCccccCCC
Q 030779          110 KRCTTCNKRVGLT--GFNCR-CGNLFCAVH  136 (171)
Q Consensus       110 ~rC~~C~kkvgl~--gf~Cr-Cg~~FC~~H  136 (171)
                      ..|..|+++.+++  ...|| ||.+||+.+
T Consensus         3 ~~C~~C~~~F~~~~rk~~Cr~Cg~~~C~~C   32 (57)
T cd00065           3 SSCMGCGKPFTLTRRRHHCRNCGRIFCSKC   32 (57)
T ss_pred             CcCcccCccccCCccccccCcCcCCcChHH
Confidence            5799999999996  69999 999999754


No 11 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG1818 consensus Membrane trafficking and cell signaling protein HRS, contains VHS and FYVE domains [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=89.50  E-value=0.13  Score=49.87  Aligned_cols=45  Identities=29%  Similarity=0.710  Sum_probs=35.2

Q ss_pred             CCCccccccccccccc--eeee-cCccccCCCC-----------CCCCCCCCccchHHH
Q 030779          108 GPKRCTTCNKRVGLTG--FNCR-CGNLFCAVHR-----------YSDKHGCPFDYRTAA  152 (171)
Q Consensus       108 ~~~rC~~C~kkvgl~g--f~Cr-Cg~~FC~~HR-----------y~e~H~C~fDyk~~~  152 (171)
                      ....|..|+.+.|+++  ..|| ||.+||+.|=           |.+.--|.-||...-
T Consensus       164 D~~~C~rCr~~F~~~~rkHHCr~CG~vFC~qcss~s~~lP~~Gi~~~VRVCd~C~E~l~  222 (634)
T KOG1818|consen  164 DSEECLRCRVKFGLTNRKHHCRNCGQVFCGQCSSKSLTLPKLGIEKPVRVCDSCYELLT  222 (634)
T ss_pred             cccccceeeeeeeeccccccccccchhhccCccccccCcccccccccceehhhhHHHhh
Confidence            3578999999999985  8999 9999999884           344566777776433


No 13 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=87.71  E-value=0.27  Score=28.67  Aligned_cols=23  Identities=35%  Similarity=0.743  Sum_probs=20.4

Q ss_pred             Cccccccccccccceeee-cCccc
Q 030779          110 KRCTTCNKRVGLTGFNCR-CGNLF  132 (171)
Q Consensus       110 ~rC~~C~kkvgl~gf~Cr-Cg~~F  132 (171)
                      .+|-.|++.|.+..-.|- ||+.|
T Consensus         1 K~CP~C~~~V~~~~~~Cp~CG~~F   24 (26)
T PF10571_consen    1 KTCPECGAEVPESAKFCPHCGYDF   24 (26)
T ss_pred             CcCCCCcCCchhhcCcCCCCCCCC
Confidence            368999999999999999 99887


No 14 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=84.27  E-value=0.64  Score=29.90  Aligned_cols=24  Identities=38%  Similarity=1.054  Sum_probs=18.5

Q ss_pred             CCCccccccccc---cccceeee-cCcc
Q 030779          108 GPKRCTTCNKRV---GLTGFNCR-CGNL  131 (171)
Q Consensus       108 ~~~rC~~C~kkv---gl~gf~Cr-Cg~~  131 (171)
                      .+..|..|++.|   ++.|++|+ |+.+
T Consensus        10 ~~~~C~~C~~~i~g~~~~g~~C~~C~~~   37 (53)
T PF00130_consen   10 KPTYCDVCGKFIWGLGKQGYRCSWCGLV   37 (53)
T ss_dssp             STEB-TTSSSBECSSSSCEEEETTTT-E
T ss_pred             CCCCCcccCcccCCCCCCeEEECCCCCh
Confidence            467999999999   56799999 7654


No 15 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=81.57  E-value=0.81  Score=40.22  Aligned_cols=30  Identities=33%  Similarity=0.849  Sum_probs=23.9

Q ss_pred             CCCCCCcccccccc---------ccccceeee-cCccccC
Q 030779          105 AKEGPKRCTTCNKR---------VGLTGFNCR-CGNLFCA  134 (171)
Q Consensus       105 ~~~~~~rC~~C~kk---------vgl~gf~Cr-Cg~~FC~  134 (171)
                      ..+..+||..|+||         .|+.-|+|. |+++|=+
T Consensus       128 ~rKeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G  167 (278)
T PF15135_consen  128 QRKEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRG  167 (278)
T ss_pred             cccccccccccccccCCCccccccceeeeecccccccchh
Confidence            34557999999988         677789994 9999854


No 16 
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=68.21  E-value=3  Score=28.18  Aligned_cols=23  Identities=26%  Similarity=0.759  Sum_probs=15.1

Q ss_pred             cccccccccccceeee-cCccccCC
Q 030779          112 CTTCNKRVGLTGFNCR-CGNLFCAV  135 (171)
Q Consensus       112 C~~C~kkvgl~gf~Cr-Cg~~FC~~  135 (171)
                      |..|+.. +-.-+.|- ||.++|+.
T Consensus         1 C~~C~~~-~~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    1 CSVCGST-NSNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             -SSSHTC-SSSEEEETTTS-EEETT
T ss_pred             CCCCCCc-CCceEEeCCCCcccccC
Confidence            5667755 34457788 99999994


No 17 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=66.45  E-value=2  Score=28.60  Aligned_cols=22  Identities=36%  Similarity=1.126  Sum_probs=17.0

Q ss_pred             cccccccccccc-------ceeee-cCccc
Q 030779          111 RCTTCNKRVGLT-------GFNCR-CGNLF  132 (171)
Q Consensus       111 rC~~C~kkvgl~-------gf~Cr-Cg~~F  132 (171)
                      +|..|++++||+       ||.|. |-.-.
T Consensus         1 ~C~iCg~kigl~~~~k~~DG~iC~~C~~Kl   30 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDGYICKDCLKKL   30 (51)
T ss_pred             CCCccccccccccceeccCccchHHHHHHh
Confidence            599999999997       57787 65443


No 18 
>KOG1729 consensus FYVE finger containing protein [General function prediction only]
Probab=59.60  E-value=2.6  Score=37.34  Aligned_cols=33  Identities=27%  Similarity=0.761  Sum_probs=27.1

Q ss_pred             CCCCccccccc-ccccc--ceeee-cCccccCCCCCCC
Q 030779          107 EGPKRCTTCNK-RVGLT--GFNCR-CGNLFCAVHRYSD  140 (171)
Q Consensus       107 ~~~~rC~~C~k-kvgl~--gf~Cr-Cg~~FC~~HRy~e  140 (171)
                      ...++|..|.+ .-.|.  --+|| ||.+||. |.-..
T Consensus       166 ~ea~~C~~C~~~~Ftl~~RRHHCR~CG~ivC~-~Cs~n  202 (288)
T KOG1729|consen  166 SEATECMVCGCTEFTLSERRHHCRNCGDIVCA-PCSRN  202 (288)
T ss_pred             ccceecccCCCccccHHHHHHHHHhcchHhhh-hhhcC
Confidence            35689999999 77776  47899 9999999 87544


No 19 
>PF13978 DUF4223:  Protein of unknown function (DUF4223)
Probab=58.36  E-value=4.7  Score=27.57  Aligned_cols=18  Identities=28%  Similarity=0.717  Sum_probs=16.2

Q ss_pred             ccCCCCCCCCCCCCccch
Q 030779          132 FCAVHRYSDKHGCPFDYR  149 (171)
Q Consensus       132 FC~~HRy~e~H~C~fDyk  149 (171)
                      -|--|-|-.+.+|+|||-
T Consensus        19 ~CTG~v~Nk~knCsYDYl   36 (56)
T PF13978_consen   19 ACTGHVENKEKNCSYDYL   36 (56)
T ss_pred             hccceeeccCCCCcceee
Confidence            477899999999999996


No 20 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=58.32  E-value=5.5  Score=24.33  Aligned_cols=24  Identities=29%  Similarity=0.800  Sum_probs=18.6

Q ss_pred             CCCcccccccccccc--ceeee-cCcc
Q 030779          108 GPKRCTTCNKRVGLT--GFNCR-CGNL  131 (171)
Q Consensus       108 ~~~rC~~C~kkvgl~--gf~Cr-Cg~~  131 (171)
                      .+..|..|++.+...  |++|+ |+.+
T Consensus        10 ~~~~C~~C~~~i~~~~~~~~C~~C~~~   36 (49)
T smart00109       10 KPTKCCVCRKSIWGSFQGLRCSWCKVK   36 (49)
T ss_pred             CCCCccccccccCcCCCCcCCCCCCch
Confidence            357899999999873  88888 6543


No 21 
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=58.11  E-value=5.5  Score=24.64  Aligned_cols=24  Identities=29%  Similarity=0.704  Sum_probs=19.1

Q ss_pred             CCCccccccccccc---cceeee-cCcc
Q 030779          108 GPKRCTTCNKRVGL---TGFNCR-CGNL  131 (171)
Q Consensus       108 ~~~rC~~C~kkvgl---~gf~Cr-Cg~~  131 (171)
                      .+..|..|++.+..   .|++|+ |+.+
T Consensus        10 ~~~~C~~C~~~i~~~~~~~~~C~~C~~~   37 (50)
T cd00029          10 KPTFCDVCRKSIWGLFKQGLRCSWCKVK   37 (50)
T ss_pred             CCCChhhcchhhhccccceeEcCCCCCc
Confidence            35689999999985   689999 7554


No 22 
>PHA02768 hypothetical protein; Provisional
Probab=57.48  E-value=4.3  Score=27.74  Aligned_cols=16  Identities=31%  Similarity=1.036  Sum_probs=12.6

Q ss_pred             cccceeee-cCccccCC
Q 030779          120 GLTGFNCR-CGNLFCAV  135 (171)
Q Consensus       120 gl~gf~Cr-Cg~~FC~~  135 (171)
                      .|+||.|- ||..|-..
T Consensus         2 ~~~~y~C~~CGK~Fs~~   18 (55)
T PHA02768          2 ALLGYECPICGEIYIKR   18 (55)
T ss_pred             cccccCcchhCCeeccH
Confidence            47899998 98888653


No 23 
>KOG1819 consensus FYVE finger-containing proteins [General function prediction only]
Probab=55.80  E-value=6.4  Score=38.31  Aligned_cols=30  Identities=27%  Similarity=0.833  Sum_probs=22.1

Q ss_pred             CCCcccccccccccc--ceeee-cCccccCCCC
Q 030779          108 GPKRCTTCNKRVGLT--GFNCR-CGNLFCAVHR  137 (171)
Q Consensus       108 ~~~rC~~C~kkvgl~--gf~Cr-Cg~~FC~~HR  137 (171)
                      +..+|..|.......  --.|| ||++||++--
T Consensus       900 ~a~~cmacq~pf~afrrrhhcrncggifcg~cs  932 (990)
T KOG1819|consen  900 DAEQCMACQMPFNAFRRRHHCRNCGGIFCGKCS  932 (990)
T ss_pred             cchhhhhccCcHHHHHHhhhhcccCceeecccc
Confidence            457899997655442  46899 9999998643


No 24 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=54.95  E-value=6.4  Score=27.40  Aligned_cols=13  Identities=54%  Similarity=1.081  Sum_probs=10.0

Q ss_pred             CCccccccccccc
Q 030779          109 PKRCTTCNKRVGL  121 (171)
Q Consensus       109 ~~rC~~C~kkvgl  121 (171)
                      |-||++|+|-+|-
T Consensus         4 PVRCFTCGkvi~~   16 (60)
T PF01194_consen    4 PVRCFTCGKVIGN   16 (60)
T ss_dssp             SSS-STTTSBTCG
T ss_pred             ceecCCCCCChhH
Confidence            6799999998863


No 25 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=54.35  E-value=5.3  Score=26.76  Aligned_cols=22  Identities=36%  Similarity=1.076  Sum_probs=17.4

Q ss_pred             CCcccccccccccc----ceeee-cCc
Q 030779          109 PKRCTTCNKRVGLT----GFNCR-CGN  130 (171)
Q Consensus       109 ~~rC~~C~kkvgl~----gf~Cr-Cg~  130 (171)
                      .-+|..|++++.|.    +..|. ||+
T Consensus         6 ~Y~C~~Cg~~~~~~~~~~~irCp~Cg~   32 (49)
T COG1996           6 EYKCARCGREVELDQETRGIRCPYCGS   32 (49)
T ss_pred             EEEhhhcCCeeehhhccCceeCCCCCc
Confidence            46899999999854    79998 754


No 26 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=52.89  E-value=6.9  Score=30.40  Aligned_cols=33  Identities=18%  Similarity=0.365  Sum_probs=24.7

Q ss_pred             ccccccccccceeeecCccccCCCCCCCCCCCCcc
Q 030779          113 TTCNKRVGLTGFNCRCGNLFCAVHRYSDKHGCPFD  147 (171)
Q Consensus       113 ~~C~kkvgl~gf~CrCg~~FC~~HRy~e~H~C~fD  147 (171)
                      +.|+++-  .-.+|+||+.||+-+.--..|.=-++
T Consensus        16 ~i~~~~~--k~vkc~CGh~f~d~r~NwK~~alv~v   48 (112)
T PF08882_consen   16 WIVQKKD--KVVKCDCGHEFCDARENWKLGALVYV   48 (112)
T ss_pred             EEEEecC--ceeeccCCCeecChhcChhhCcEEEe
Confidence            5666655  25899999999999887777765554


No 27 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=51.12  E-value=6.9  Score=22.73  Aligned_cols=22  Identities=27%  Similarity=0.671  Sum_probs=8.9

Q ss_pred             ccccccccccc-cceeee-cCccc
Q 030779          111 RCTTCNKRVGL-TGFNCR-CGNLF  132 (171)
Q Consensus       111 rC~~C~kkvgl-~gf~Cr-Cg~~F  132 (171)
                      +|..|++.+.. ..|.|. |...+
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~Cdf~l   25 (30)
T PF07649_consen    2 RCDACGKPIDGGWFYRCSECDFDL   25 (30)
T ss_dssp             --TTTS----S--EEE-TTT----
T ss_pred             cCCcCCCcCCCCceEECccCCCcc
Confidence            68999999988 789998 76554


No 28 
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=50.32  E-value=8.6  Score=35.09  Aligned_cols=31  Identities=32%  Similarity=0.907  Sum_probs=25.7

Q ss_pred             CCCCcccccccccccc-c---eeeecCccccCCCC
Q 030779          107 EGPKRCTTCNKRVGLT-G---FNCRCGNLFCAVHR  137 (171)
Q Consensus       107 ~~~~rC~~C~kkvgl~-g---f~CrCg~~FC~~HR  137 (171)
                      +.-.+|..|+--+-|. |   +.||||+.||-.=.
T Consensus       304 ~~wr~CpkC~~~ie~~~GCnhm~CrC~~~fcy~C~  338 (384)
T KOG1812|consen  304 KRWRQCPKCKFMIELSEGCNHMTCRCGHQFCYMCG  338 (384)
T ss_pred             HhcCcCcccceeeeecCCcceEEeeccccchhhcC
Confidence            4468999999998886 3   99999999997655


No 29 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=50.31  E-value=5.9  Score=27.76  Aligned_cols=14  Identities=43%  Similarity=0.757  Sum_probs=11.4

Q ss_pred             CCCccccccccccc
Q 030779          108 GPKRCTTCNKRVGL  121 (171)
Q Consensus       108 ~~~rC~~C~kkvgl  121 (171)
                      .|-||++|+|-+|-
T Consensus         3 iPvRCFTCGkvi~~   16 (62)
T PRK04016          3 IPVRCFTCGKVIAE   16 (62)
T ss_pred             CCeEecCCCCChHH
Confidence            36799999998864


No 30 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=48.88  E-value=6.7  Score=28.21  Aligned_cols=13  Identities=54%  Similarity=1.081  Sum_probs=11.0

Q ss_pred             CCccccccccccc
Q 030779          109 PKRCTTCNKRVGL  121 (171)
Q Consensus       109 ~~rC~~C~kkvgl  121 (171)
                      |-||++|+|-+|-
T Consensus         4 PVRCFTCGkvig~   16 (71)
T PLN00032          4 PVRCFTCGKVIGN   16 (71)
T ss_pred             ceeecCCCCCcHH
Confidence            6799999998864


No 31 
>PF05207 zf-CSL:  CSL zinc finger;  InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a probable zinc binding motif that contains four cysteines and may chelate zinc, known as the DPH-type after the diphthamide (DPH) biosynthesis protein in which it was first characterised, including the proteins DPH3 and DPH4. This domain is also found associated with N-terminal domain of heat shock protein DnaJ IPR001623 from INTERPRO domain.  Diphthamide is a unique post-translationally modified histidine residue found only in translation elongation factor 2 (eEF-2). It is conserved from archaea to humans and serves as the target for diphteria toxin and Pseudomonas exotoxin A. These two toxins catalyse the transfer of ADP-ribose to diphtamide on eEF-2, thus inactivating eEF-2, halting cellular protein synthesis, and causing cell death []. The biosynthesis of diphtamide is dependent on at least five proteins, DPH1 to -5, and a still unidentified amidating enzyme. DPH3 and DPH4 share a conserved region, which encode a putative zinc finger, the DPH-type or CSL-type (after the conserved motif of the final cysteine) zinc finger [, ]. The function of this motif is unknown. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2L6L_A 1WGE_A 2JR7_A 1YOP_A 1YWS_A.
Probab=48.36  E-value=8  Score=25.92  Aligned_cols=13  Identities=38%  Similarity=1.035  Sum_probs=10.3

Q ss_pred             ccceeeecCcccc
Q 030779          121 LTGFNCRCGNLFC  133 (171)
Q Consensus       121 l~gf~CrCg~~FC  133 (171)
                      ...+.||||..|-
T Consensus        16 ~~~y~CRCG~~f~   28 (55)
T PF05207_consen   16 VYSYPCRCGGEFE   28 (55)
T ss_dssp             EEEEEETTSSEEE
T ss_pred             EEEEcCCCCCEEE
Confidence            3468999999874


No 32 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=45.99  E-value=15  Score=21.48  Aligned_cols=20  Identities=20%  Similarity=0.708  Sum_probs=16.5

Q ss_pred             cccccccccccc-ceeee-cCc
Q 030779          111 RCTTCNKRVGLT-GFNCR-CGN  130 (171)
Q Consensus       111 rC~~C~kkvgl~-gf~Cr-Cg~  130 (171)
                      .|..|++++.-. .|.|. |+.
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~c~f   23 (30)
T PF03107_consen    2 WCDVCRRKIDGFYFYHCSECCF   23 (30)
T ss_pred             CCCCCCCCcCCCEeEEeCCCCC
Confidence            488999999888 89997 653


No 33 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=45.68  E-value=7.5  Score=24.55  Aligned_cols=24  Identities=29%  Similarity=0.757  Sum_probs=17.6

Q ss_pred             ccccccccccccceeee-cCccccCCC
Q 030779          111 RCTTCNKRVGLTGFNCR-CGNLFCAVH  136 (171)
Q Consensus       111 rC~~C~kkvgl~gf~Cr-Cg~~FC~~H  136 (171)
                      ||..|.....  -+.|- |+.++|+..
T Consensus         1 ~C~~C~~~~~--l~~CL~C~~~~c~~~   25 (50)
T smart00290        1 RCSVCGTIEN--LWLCLTCGQVGCGRY   25 (50)
T ss_pred             CcccCCCcCC--eEEecCCCCcccCCC
Confidence            6888886554  35666 999999764


No 34 
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=44.48  E-value=12  Score=38.27  Aligned_cols=27  Identities=26%  Similarity=0.790  Sum_probs=21.0

Q ss_pred             Cccccccccccc-------cceeee-cCccccCCC
Q 030779          110 KRCTTCNKRVGL-------TGFNCR-CGNLFCAVH  136 (171)
Q Consensus       110 ~rC~~C~kkvgl-------~gf~Cr-Cg~~FC~~H  136 (171)
                      ..|..|+++-+.       .--+|| ||.+||+..
T Consensus       461 dtC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~C  495 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFC  495 (1374)
T ss_pred             CcccCcCCcccccccccccccccccCCccccCccc
Confidence            569999999863       245699 999998643


No 35 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=42.94  E-value=17  Score=27.41  Aligned_cols=31  Identities=26%  Similarity=0.652  Sum_probs=24.1

Q ss_pred             CCcccccccccccc---ceeee-cCccccCCCCCC
Q 030779          109 PKRCTTCNKRVGLT---GFNCR-CGNLFCAVHRYS  139 (171)
Q Consensus       109 ~~rC~~C~kkvgl~---gf~Cr-Cg~~FC~~HRy~  139 (171)
                      ...|..|.+.+|++   |..|. |...+|..=+.-
T Consensus        54 ~~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~~~   88 (118)
T PF02318_consen   54 ERHCARCGKPFGFLFNRGRVCVDCKHRVCKKCGVY   88 (118)
T ss_dssp             CSB-TTTS-BCSCTSTTCEEETTTTEEEETTSEEE
T ss_pred             CcchhhhCCcccccCCCCCcCCcCCccccCccCCc
Confidence            46899999999986   68999 999999876653


No 36 
>PF02928 zf-C5HC2:  C5HC2 zinc finger;  InterPro: IPR004198 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a predicted zinc finger with eight potential zinc ligand binding residues. This domain is found in Jumonji [], and may have a DNA binding function. The mouse jumonji protein is required for neural tube formation, and is essential for normal heart development. It also plays a role in the down-regulation of cell proliferation signalling. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005634 nucleus
Probab=42.39  E-value=12  Score=24.69  Aligned_cols=26  Identities=27%  Similarity=0.825  Sum_probs=22.2

Q ss_pred             cccccccccccceeeec--CccccCCCC
Q 030779          112 CTTCNKRVGLTGFNCRC--GNLFCAVHR  137 (171)
Q Consensus       112 C~~C~kkvgl~gf~CrC--g~~FC~~HR  137 (171)
                      |..|+.-.=|..+.|.|  +.++|-.|-
T Consensus         1 C~~Ck~~~yLS~v~C~C~~~~~~CL~H~   28 (54)
T PF02928_consen    1 CSICKAYCYLSAVTCSCKPDKVVCLRHA   28 (54)
T ss_pred             CcccCCchhhcccccCCCCCcEEccccc
Confidence            67788888888999997  899999885


No 37 
>KOG3497 consensus DNA-directed RNA polymerase, subunit RPB10 [Transcription]
Probab=42.25  E-value=8.6  Score=27.22  Aligned_cols=13  Identities=54%  Similarity=1.045  Sum_probs=11.0

Q ss_pred             CCccccccccccc
Q 030779          109 PKRCTTCNKRVGL  121 (171)
Q Consensus       109 ~~rC~~C~kkvgl  121 (171)
                      |-||++|+|-+|-
T Consensus         4 PiRCFtCGKvig~   16 (69)
T KOG3497|consen    4 PIRCFTCGKVIGD   16 (69)
T ss_pred             eeEeeeccccccc
Confidence            6799999998874


No 38 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=42.24  E-value=12  Score=22.83  Aligned_cols=18  Identities=39%  Similarity=1.060  Sum_probs=9.5

Q ss_pred             ccccccccccc---ceeee-cC
Q 030779          112 CTTCNKRVGLT---GFNCR-CG  129 (171)
Q Consensus       112 C~~C~kkvgl~---gf~Cr-Cg  129 (171)
                      |..|+..+.|.   ..+|+ ||
T Consensus         3 C~~Cg~~~~~~~~~~irC~~CG   24 (32)
T PF03604_consen    3 CGECGAEVELKPGDPIRCPECG   24 (32)
T ss_dssp             ESSSSSSE-BSTSSTSSBSSSS
T ss_pred             CCcCCCeeEcCCCCcEECCcCC
Confidence            55566666653   35666 54


No 39 
>PRK08402 replication factor A; Reviewed
Probab=42.06  E-value=12  Score=33.93  Aligned_cols=28  Identities=18%  Similarity=0.510  Sum_probs=18.6

Q ss_pred             Cccccccccccc----cceeee-cCccccCCCCC
Q 030779          110 KRCTTCNKRVGL----TGFNCR-CGNLFCAVHRY  138 (171)
Q Consensus       110 ~rC~~C~kkvgl----~gf~Cr-Cg~~FC~~HRy  138 (171)
                      .+|..|+|||-.    -.+.|. ||.+-+ .|||
T Consensus       213 ~aCp~CnKkv~~~~~~~~~~Ce~~~~v~p-~~ry  245 (355)
T PRK08402        213 DACPECRRKVDYDPATDTWICPEHGEVEP-IKIT  245 (355)
T ss_pred             ecCCCCCeEEEEecCCCCEeCCCCCCcCc-ceeE
Confidence            699999999953    247777 554333 4554


No 40 
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=42.05  E-value=16  Score=33.56  Aligned_cols=29  Identities=28%  Similarity=0.849  Sum_probs=23.4

Q ss_pred             CCCCccccc-cccccccceeee-cCccccCC
Q 030779          107 EGPKRCTTC-NKRVGLTGFNCR-CGNLFCAV  135 (171)
Q Consensus       107 ~~~~rC~~C-~kkvgl~gf~Cr-Cg~~FC~~  135 (171)
                      ...++|+.| .+.++-..|.|. |-++||..
T Consensus       328 ~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCld  358 (378)
T KOG2807|consen  328 NGSRFCFACQGELLSSGRYRCESCKNVFCLD  358 (378)
T ss_pred             CCCcceeeeccccCCCCcEEchhccceeecc
Confidence            356789999 666666789999 99999963


No 41 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=41.73  E-value=13  Score=23.97  Aligned_cols=20  Identities=30%  Similarity=0.868  Sum_probs=14.2

Q ss_pred             Ccccccccccccc---ceeee-cC
Q 030779          110 KRCTTCNKRVGLT---GFNCR-CG  129 (171)
Q Consensus       110 ~rC~~C~kkvgl~---gf~Cr-Cg  129 (171)
                      -+|..|+..+.+.   +.+|+ ||
T Consensus         3 Y~C~~Cg~~~~~~~~~~irC~~CG   26 (44)
T smart00659        3 YICGECGRENEIKSKDVVRCRECG   26 (44)
T ss_pred             EECCCCCCEeecCCCCceECCCCC
Confidence            3688888888775   57776 64


No 42 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=40.04  E-value=12  Score=25.11  Aligned_cols=34  Identities=32%  Similarity=0.756  Sum_probs=15.8

Q ss_pred             ccccccccccc--------ceeee-cCccccCC---CCCCCCCCCC
Q 030779          112 CTTCNKRVGLT--------GFNCR-CGNLFCAV---HRYSDKHGCP  145 (171)
Q Consensus       112 C~~C~kkvgl~--------gf~Cr-Cg~~FC~~---HRy~e~H~C~  145 (171)
                      |+.|.+.+.-.        .|.|. |+..||..   -=+-.-|+|+
T Consensus         2 CfgC~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fiHE~LH~CP   47 (51)
T PF07975_consen    2 CFGCQKPFPDGPEKKADSSRYRCPKCKNHFCIDCDVFIHETLHNCP   47 (51)
T ss_dssp             ETTTTEE-TTS-------EEE--TTTT--B-HHHHHTTTTTS-SSS
T ss_pred             CccCCCCCCCcccccccCCeEECCCCCCccccCcChhhhccccCCc
Confidence            56666666653        48897 99999852   2223456664


No 43 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=39.90  E-value=13  Score=34.77  Aligned_cols=26  Identities=31%  Similarity=0.800  Sum_probs=20.2

Q ss_pred             CCcccccccccccc---ceeee-cCccccC
Q 030779          109 PKRCTTCNKRVGLT---GFNCR-CGNLFCA  134 (171)
Q Consensus       109 ~~rC~~C~kkvgl~---gf~Cr-Cg~~FC~  134 (171)
                      .-+|-.|++++.-.   ||+|+ ||..+=.
T Consensus       350 ~p~Cp~Cg~~m~S~G~~g~rC~kCg~~~~~  379 (421)
T COG1571         350 NPVCPRCGGRMKSAGRNGFRCKKCGTRARE  379 (421)
T ss_pred             CCCCCccCCchhhcCCCCcccccccccCCc
Confidence            35899999988654   79999 9876643


No 44 
>PHA00626 hypothetical protein
Probab=39.73  E-value=15  Score=25.52  Aligned_cols=22  Identities=18%  Similarity=0.292  Sum_probs=13.8

Q ss_pred             Cccccccccccccceeee-cCcccc
Q 030779          110 KRCTTCNKRVGLTGFNCR-CGNLFC  133 (171)
Q Consensus       110 ~rC~~C~kkvgl~gf~Cr-Cg~~FC  133 (171)
                      .||.+|++..  .-|+|. ||+.|-
T Consensus        12 vrcg~cr~~s--nrYkCkdCGY~ft   34 (59)
T PHA00626         12 AKEKTMRGWS--DDYVCCDCGYNDS   34 (59)
T ss_pred             eeeceecccC--cceEcCCCCCeec
Confidence            3677776522  248887 877764


No 45 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=38.84  E-value=14  Score=28.98  Aligned_cols=31  Identities=29%  Similarity=0.609  Sum_probs=22.4

Q ss_pred             CCcccccccccccc---ceeee-cCccc-cCCCCCC
Q 030779          109 PKRCTTCNKRVGLT---GFNCR-CGNLF-CAVHRYS  139 (171)
Q Consensus       109 ~~rC~~C~kkvgl~---gf~Cr-Cg~~F-C~~HRy~  139 (171)
                      =..|..|+|||-..   .|.|. |+..+ =-.+||-
T Consensus        34 Y~aC~~C~kkv~~~~~~~~~C~~C~~~~~~~~~ry~   69 (166)
T cd04476          34 YPACPGCNKKVVEEGNGTYRCEKCNKSVPNPEYRYI   69 (166)
T ss_pred             EccccccCcccEeCCCCcEECCCCCCcCCCccEEEE
Confidence            45688999999765   38888 77765 4566764


No 46 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=38.66  E-value=17  Score=20.31  Aligned_cols=20  Identities=25%  Similarity=0.730  Sum_probs=10.9

Q ss_pred             ccccccccccccceeee-cCc
Q 030779          111 RCTTCNKRVGLTGFNCR-CGN  130 (171)
Q Consensus       111 rC~~C~kkvgl~gf~Cr-Cg~  130 (171)
                      +|..|++++.-..-.|. ||.
T Consensus         1 ~Cp~CG~~~~~~~~fC~~CG~   21 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCPNCGT   21 (23)
T ss_pred             CCcccCCCCCCcCcchhhhCC
Confidence            36666666655444455 443


No 47 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=38.52  E-value=10  Score=26.66  Aligned_cols=13  Identities=46%  Similarity=1.083  Sum_probs=10.8

Q ss_pred             CCccccccccccc
Q 030779          109 PKRCTTCNKRVGL  121 (171)
Q Consensus       109 ~~rC~~C~kkvgl  121 (171)
                      |-||++|+|-+|-
T Consensus         4 PiRCFsCGkvi~~   16 (63)
T COG1644           4 PVRCFSCGKVIGH   16 (63)
T ss_pred             ceEeecCCCCHHH
Confidence            6799999998853


No 48 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=37.01  E-value=16  Score=22.63  Aligned_cols=22  Identities=36%  Similarity=1.007  Sum_probs=17.4

Q ss_pred             Ccccccccccccc--c-eee-ecCcc
Q 030779          110 KRCTTCNKRVGLT--G-FNC-RCGNL  131 (171)
Q Consensus       110 ~rC~~C~kkvgl~--g-f~C-rCg~~  131 (171)
                      -+|..|+-+...+  | |.| +||.+
T Consensus         9 ~~C~~C~~~~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen    9 EPCPVCGSRWFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             CcCCCCCCeEeEccCCEEEhhhCceE
Confidence            4699999997765  4 899 79875


No 49 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=34.66  E-value=21  Score=21.91  Aligned_cols=9  Identities=44%  Similarity=1.471  Sum_probs=4.9

Q ss_pred             eeee-cCccc
Q 030779          124 FNCR-CGNLF  132 (171)
Q Consensus       124 f~Cr-Cg~~F  132 (171)
                      .+|. ||.+|
T Consensus        26 v~C~~C~~~f   35 (36)
T PF13717_consen   26 VRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEe
Confidence            5555 65554


No 50 
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=34.00  E-value=10  Score=35.94  Aligned_cols=25  Identities=40%  Similarity=1.116  Sum_probs=22.0

Q ss_pred             Ccccccccccccc--ceeee-cCccccC
Q 030779          110 KRCTTCNKRVGLT--GFNCR-CGNLFCA  134 (171)
Q Consensus       110 ~rC~~C~kkvgl~--gf~Cr-Cg~~FC~  134 (171)
                      .-|..|.++.||+  --.|| ||.+.|.
T Consensus       181 ~~CP~Ca~~F~l~rRrHHCRLCG~VmC~  208 (505)
T KOG1842|consen  181 QFCPECANSFGLTRRRHHCRLCGRVMCR  208 (505)
T ss_pred             cccccccchhhhHHHhhhhhhcchHHHH
Confidence            4799999999997  68999 9999884


No 51 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=32.51  E-value=31  Score=24.40  Aligned_cols=24  Identities=29%  Similarity=0.789  Sum_probs=16.5

Q ss_pred             CCccccccccccccceeee-cCccc
Q 030779          109 PKRCTTCNKRVGLTGFNCR-CGNLF  132 (171)
Q Consensus       109 ~~rC~~C~kkvgl~gf~Cr-Cg~~F  132 (171)
                      ...|..|+|++|...|.=- ||.+|
T Consensus        78 ~~~C~vC~k~l~~~~f~~~p~~~v~  102 (109)
T PF10367_consen   78 STKCSVCGKPLGNSVFVVFPCGHVV  102 (109)
T ss_pred             CCCccCcCCcCCCceEEEeCCCeEE
Confidence            4579999999998654333 55444


No 52 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=32.46  E-value=35  Score=20.50  Aligned_cols=26  Identities=31%  Similarity=0.810  Sum_probs=18.5

Q ss_pred             cccccccccc-c-cceeee-cCccccCCC
Q 030779          111 RCTTCNKRVG-L-TGFNCR-CGNLFCAVH  136 (171)
Q Consensus       111 rC~~C~kkvg-l-~gf~Cr-Cg~~FC~~H  136 (171)
                      ||..|.++-- - +.|.|. |+-.+|..|
T Consensus         2 rC~vC~~~k~rk~T~~~C~~C~v~lC~~~   30 (32)
T PF13842_consen    2 RCKVCSKKKRRKDTRYMCSKCDVPLCVEP   30 (32)
T ss_pred             CCeECCcCCccceeEEEccCCCCcccCCC
Confidence            6777776432 2 679998 887777766


No 53 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=32.27  E-value=27  Score=21.87  Aligned_cols=20  Identities=25%  Similarity=0.750  Sum_probs=16.4

Q ss_pred             ccceeee-cCccccCCCCCCC
Q 030779          121 LTGFNCR-CGNLFCAVHRYSD  140 (171)
Q Consensus       121 l~gf~Cr-Cg~~FC~~HRy~e  140 (171)
                      +-.|+|. ||..|=-.+.+.+
T Consensus         3 ~Yey~C~~Cg~~fe~~~~~~~   23 (42)
T PF09723_consen    3 IYEYRCEECGHEFEVLQSISE   23 (42)
T ss_pred             CEEEEeCCCCCEEEEEEEcCC
Confidence            4569999 9999988887776


No 54 
>PF15549 PGC7_Stella:  PGC7/Stella/Dppa3 domain 
Probab=31.76  E-value=25  Score=28.91  Aligned_cols=19  Identities=32%  Similarity=0.968  Sum_probs=15.2

Q ss_pred             ceeeecCccccCCCCCCCCCC
Q 030779          123 GFNCRCGNLFCAVHRYSDKHG  143 (171)
Q Consensus       123 gf~CrCg~~FC~~HRy~e~H~  143 (171)
                      -|+|.|  .||-.||.|.+-+
T Consensus       123 ~FrC~C--~yC~~~~~~~~~n  141 (160)
T PF15549_consen  123 RFRCEC--HYCQSHRNPGERN  141 (160)
T ss_pred             ceeeee--eeecccCCCcccc
Confidence            389998  7999999766555


No 55 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=31.30  E-value=32  Score=22.07  Aligned_cols=18  Identities=28%  Similarity=0.779  Sum_probs=14.9

Q ss_pred             cceee-ecCccccCCCCCC
Q 030779          122 TGFNC-RCGNLFCAVHRYS  139 (171)
Q Consensus       122 ~gf~C-rCg~~FC~~HRy~  139 (171)
                      ....| .||..||-.++.+
T Consensus        39 ~~v~C~~C~~~fC~~C~~~   57 (64)
T smart00647       39 NRVTCPKCGFSFCFRCKVP   57 (64)
T ss_pred             CeeECCCCCCeECCCCCCc
Confidence            35889 7999999988865


No 56 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=31.20  E-value=28  Score=19.70  Aligned_cols=21  Identities=24%  Similarity=0.680  Sum_probs=12.5

Q ss_pred             Cccccccccccccceeee-cCc
Q 030779          110 KRCTTCNKRVGLTGFNCR-CGN  130 (171)
Q Consensus       110 ~rC~~C~kkvgl~gf~Cr-Cg~  130 (171)
                      ..|..|++.+.-..-.|. ||.
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCcccccChhhCC
Confidence            467777776555555555 543


No 57 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=30.78  E-value=25  Score=23.49  Aligned_cols=23  Identities=39%  Similarity=0.843  Sum_probs=19.2

Q ss_pred             CCCccccccccccccceeee-cCc
Q 030779          108 GPKRCTTCNKRVGLTGFNCR-CGN  130 (171)
Q Consensus       108 ~~~rC~~C~kkvgl~gf~Cr-Cg~  130 (171)
                      .+.-|..|+-++....-.|| ||+
T Consensus        13 ~k~ICrkC~ARnp~~A~~CRKCg~   36 (48)
T PRK04136         13 NKKICMRCNARNPWRATKCRKCGY   36 (48)
T ss_pred             cccchhcccCCCCccccccccCCC
Confidence            35678999999999999999 775


No 58 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=29.94  E-value=18  Score=21.52  Aligned_cols=23  Identities=30%  Similarity=1.086  Sum_probs=15.4

Q ss_pred             Cccccccccccccceeee-cCccccCC
Q 030779          110 KRCTTCNKRVGLTGFNCR-CGNLFCAV  135 (171)
Q Consensus       110 ~rC~~C~kkvgl~gf~Cr-Cg~~FC~~  135 (171)
                      ..|..|+.   ..-+.|. |+..||+.
T Consensus         3 ~~C~vC~~---~~kY~Cp~C~~~~CSl   26 (30)
T PF04438_consen    3 KLCSVCGN---PAKYRCPRCGARYCSL   26 (30)
T ss_dssp             EEETSSSS---EESEE-TTT--EESSH
T ss_pred             CCCccCcC---CCEEECCCcCCceeCc
Confidence            46888887   5568998 99999985


No 59 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=29.41  E-value=28  Score=21.95  Aligned_cols=28  Identities=32%  Similarity=0.795  Sum_probs=17.6

Q ss_pred             Ccccccccccccc----ceeee-cCccccCCCC
Q 030779          110 KRCTTCNKRVGLT----GFNCR-CGNLFCAVHR  137 (171)
Q Consensus       110 ~rC~~C~kkvgl~----gf~Cr-Cg~~FC~~HR  137 (171)
                      -+|..|+..+-+.    .++|. ||..+--.+|
T Consensus         4 y~C~~CG~~~~~~~~~~~~~Cp~CG~~~~~~~~   36 (46)
T PRK00398          4 YKCARCGREVELDEYGTGVRCPYCGYRILFKER   36 (46)
T ss_pred             EECCCCCCEEEECCCCCceECCCCCCeEEEccC
Confidence            4788888877552    47787 6655443333


No 60 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=29.14  E-value=32  Score=25.24  Aligned_cols=14  Identities=14%  Similarity=0.494  Sum_probs=11.7

Q ss_pred             CCcccccccccccc
Q 030779          109 PKRCTTCNKRVGLT  122 (171)
Q Consensus       109 ~~rC~~C~kkvgl~  122 (171)
                      +++|..|++++...
T Consensus        33 rS~C~~C~~~L~~~   46 (92)
T PF06750_consen   33 RSHCPHCGHPLSWW   46 (92)
T ss_pred             CCcCcCCCCcCccc
Confidence            58999999998764


No 61 
>PRK07218 replication factor A; Provisional
Probab=29.07  E-value=25  Score=32.74  Aligned_cols=21  Identities=29%  Similarity=0.729  Sum_probs=15.9

Q ss_pred             CCccccccccccccceeee-cCcc
Q 030779          109 PKRCTTCNKRVGLTGFNCR-CGNL  131 (171)
Q Consensus       109 ~~rC~~C~kkvgl~gf~Cr-Cg~~  131 (171)
                      -.||..|+|+|..  +.|+ ||.+
T Consensus       297 i~rCP~C~r~v~~--~~C~~hG~v  318 (423)
T PRK07218        297 IERCPECGRVIQK--GQCRSHGAV  318 (423)
T ss_pred             eecCcCccccccC--CcCCCCCCc
Confidence            4799999999954  6777 5543


No 62 
>PF08073 CHDNT:  CHDNT (NUC034) domain;  InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [].; GO: 0003677 DNA binding, 0005524 ATP binding, 0008270 zinc ion binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=28.56  E-value=22  Score=24.31  Aligned_cols=20  Identities=40%  Similarity=0.434  Sum_probs=16.4

Q ss_pred             HHHHHHHHHhCCcccccccc
Q 030779          150 TAAREAIAKANPVVKAEKLD  169 (171)
Q Consensus       150 ~~~r~~i~k~Np~v~~~Ki~  169 (171)
                      ..=|-.|+++||++.-.||.
T Consensus        21 q~vRP~l~~~NPk~~~sKl~   40 (55)
T PF08073_consen   21 QHVRPLLAKANPKAPMSKLM   40 (55)
T ss_pred             HHHHHHHHHHCCCCcHHHHH
Confidence            34578899999999888875


No 63 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=28.11  E-value=25  Score=22.51  Aligned_cols=16  Identities=31%  Similarity=0.769  Sum_probs=14.0

Q ss_pred             eeee-cCccccCCCCCC
Q 030779          124 FNCR-CGNLFCAVHRYS  139 (171)
Q Consensus       124 f~Cr-Cg~~FC~~HRy~  139 (171)
                      +.|. |+..||..++-+
T Consensus        41 ~~C~~C~~~fC~~C~~~   57 (64)
T PF01485_consen   41 VTCPSCGTEFCFKCGEP   57 (64)
T ss_dssp             CCTTSCCSEECSSSTSE
T ss_pred             eECCCCCCcCccccCcc
Confidence            7899 999999998854


No 64 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=26.96  E-value=24  Score=23.90  Aligned_cols=24  Identities=29%  Similarity=0.715  Sum_probs=17.2

Q ss_pred             CCcccccccccccc------ceeee-cCccc
Q 030779          109 PKRCTTCNKRVGLT------GFNCR-CGNLF  132 (171)
Q Consensus       109 ~~rC~~C~kkvgl~------gf~Cr-Cg~~F  132 (171)
                      .-||..|+|.|...      ..+|- ||.++
T Consensus         4 eiRC~~CnklLa~~g~~~~leIKCpRC~tiN   34 (51)
T PF10122_consen    4 EIRCGHCNKLLAKAGEVIELEIKCPRCKTIN   34 (51)
T ss_pred             ceeccchhHHHhhhcCccEEEEECCCCCccc
Confidence            46999999988774      36674 76553


No 65 
>PF08600 Rsm1:  Rsm1-like;  InterPro: IPR013909 This entry contains Nuclear-interacting partner of ALK (NIPA) and NIPA like proteins, as well as mRNA export factor Rsm1, all of which contain a C3HC-type zinc finger. The domain represented in this entry is found C-terminal to the zinc-finger like domain IPR012935 from INTERPRO. Rsm1 is involved in mRNA export from the nucleus []. NIPA is an essential component of an SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry [].
Probab=26.62  E-value=25  Score=25.71  Aligned_cols=18  Identities=33%  Similarity=0.660  Sum_probs=14.6

Q ss_pred             CCccccccccccccceee
Q 030779          109 PKRCTTCNKRVGLTGFNC  126 (171)
Q Consensus       109 ~~rC~~C~kkvgl~gf~C  126 (171)
                      --.|..|.+||||=.|+=
T Consensus        19 ~~~C~~C~Rr~GLW~f~~   36 (91)
T PF08600_consen   19 LLSCSYCFRRLGLWMFKS   36 (91)
T ss_pred             eEEccccCcEeeeeeccc
Confidence            457999999999976653


No 66 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=26.61  E-value=28  Score=18.26  Aligned_cols=9  Identities=44%  Similarity=1.490  Sum_probs=4.5

Q ss_pred             eeee-cCccc
Q 030779          124 FNCR-CGNLF  132 (171)
Q Consensus       124 f~Cr-Cg~~F  132 (171)
                      |.|. ||..|
T Consensus         1 y~C~~C~~~f   10 (23)
T PF00096_consen    1 YKCPICGKSF   10 (23)
T ss_dssp             EEETTTTEEE
T ss_pred             CCCCCCCCcc
Confidence            3455 55554


No 67 
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]
Probab=26.03  E-value=24  Score=34.82  Aligned_cols=50  Identities=28%  Similarity=0.663  Sum_probs=32.5

Q ss_pred             Cccccccccccccceeee-cCccc---cCCCCCCCCCCCCccchHHHHHHHHHhCCccc
Q 030779          110 KRCTTCNKRVGLTGFNCR-CGNLF---CAVHRYSDKHGCPFDYRTAAREAIAKANPVVK  164 (171)
Q Consensus       110 ~rC~~C~kkvgl~gf~Cr-Cg~~F---C~~HRy~e~H~C~fDyk~~~r~~i~k~Np~v~  164 (171)
                      --|..|.+++=++||+|+ |++.|   |+.|= |  -.|. +|. -.|+.+...+|-|.
T Consensus       190 ~fC~~~~~~~l~~gfrC~~C~~KfHq~Cs~~v-p--~~C~-~~~-~~~~~~~~~~~~~~  243 (678)
T KOG0193|consen  190 AFCDSCCNKFLFTGFRCQTCGYKFHQSCSPRV-P--TSCV-NPD-HLRQLLVFEFPAVG  243 (678)
T ss_pred             hhhhhhcchhhhcccccCCCCCccccccCCCC-C--CCCC-Ccc-hHhhhhhhcccccc
Confidence            457777788878999999 99866   54443 2  2343 332 34566777777654


No 68 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=25.48  E-value=40  Score=23.89  Aligned_cols=26  Identities=23%  Similarity=0.548  Sum_probs=10.4

Q ss_pred             CccccccccccccceeeecCccccCC
Q 030779          110 KRCTTCNKRVGLTGFNCRCGNLFCAV  135 (171)
Q Consensus       110 ~rC~~C~kkvgl~gf~CrCg~~FC~~  135 (171)
                      -||..|.--+...--.-.|+++||+.
T Consensus         8 LrCs~C~~~l~~pv~l~~CeH~fCs~   33 (65)
T PF14835_consen    8 LRCSICFDILKEPVCLGGCEHIFCSS   33 (65)
T ss_dssp             TS-SSS-S--SS-B---SSS--B-TT
T ss_pred             cCCcHHHHHhcCCceeccCccHHHHH
Confidence            57888876544432334689999985


No 69 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=25.48  E-value=29  Score=21.97  Aligned_cols=27  Identities=22%  Similarity=0.533  Sum_probs=18.7

Q ss_pred             CccccccccccccceeeecCccccCCC
Q 030779          110 KRCTTCNKRVGLTGFNCRCGNLFCAVH  136 (171)
Q Consensus       110 ~rC~~C~kkvgl~gf~CrCg~~FC~~H  136 (171)
                      -+|..|++.|...+|.=+=|..||..|
T Consensus        27 f~C~~C~~~l~~~~~~~~~~~~~C~~c   53 (58)
T PF00412_consen   27 FKCSKCGKPLNDGDFYEKDGKPYCKDC   53 (58)
T ss_dssp             SBETTTTCBTTTSSEEEETTEEEEHHH
T ss_pred             cccCCCCCccCCCeeEeECCEEECHHH
Confidence            577888888877666655566666554


No 70 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=25.34  E-value=40  Score=20.87  Aligned_cols=29  Identities=21%  Similarity=0.524  Sum_probs=19.7

Q ss_pred             ccccccccccc--cceeeecCccccCCCCCC
Q 030779          111 RCTTCNKRVGL--TGFNCRCGNLFCAVHRYS  139 (171)
Q Consensus       111 rC~~C~kkvgl--~gf~CrCg~~FC~~HRy~  139 (171)
                      +|..|.++...  ..+.=.||.+||..+-..
T Consensus         1 ~C~~C~~~~~~~~~~~l~~CgH~~C~~C~~~   31 (44)
T PF14634_consen    1 HCNICFEKYSEERRPRLTSCGHIFCEKCLKK   31 (44)
T ss_pred             CCcCcCccccCCCCeEEcccCCHHHHHHHHh
Confidence            47778877722  245556999999876543


No 71 
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=24.54  E-value=34  Score=23.97  Aligned_cols=23  Identities=30%  Similarity=0.657  Sum_probs=17.7

Q ss_pred             CCCcccccccccccc---ceeee-cCc
Q 030779          108 GPKRCTTCNKRVGLT---GFNCR-CGN  130 (171)
Q Consensus       108 ~~~rC~~C~kkvgl~---gf~Cr-Cg~  130 (171)
                      -.--|.-|+-+.-|.   .+.|| ||+
T Consensus        19 miYiCgdC~~en~lk~~D~irCReCG~   45 (62)
T KOG3507|consen   19 MIYICGDCGQENTLKRGDVIRCRECGY   45 (62)
T ss_pred             EEEEeccccccccccCCCcEehhhcch
Confidence            456789999888884   49999 864


No 72 
>PRK12366 replication factor A; Reviewed
Probab=24.48  E-value=32  Score=33.43  Aligned_cols=29  Identities=28%  Similarity=0.604  Sum_probs=20.9

Q ss_pred             CCcccccccccccc--ceeee-cCccccCCCCC
Q 030779          109 PKRCTTCNKRVGLT--GFNCR-CGNLFCAVHRY  138 (171)
Q Consensus       109 ~~rC~~C~kkvgl~--gf~Cr-Cg~~FC~~HRy  138 (171)
                      -.+|..|+|||-..  .|.|. ||.+ =..|||
T Consensus       532 y~aCp~CnkKv~~~~g~~~C~~c~~~-~p~~~~  563 (637)
T PRK12366        532 LYLCPNCRKRVEEVDGEYICEFCGEV-EPNELL  563 (637)
T ss_pred             EecccccCeEeEcCCCcEECCCCCCC-CCcEEE
Confidence            37899999999653  27896 8877 335665


No 73 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=23.81  E-value=28  Score=24.36  Aligned_cols=21  Identities=38%  Similarity=1.083  Sum_probs=13.6

Q ss_pred             CCCccccccccccccceee-ecCc
Q 030779          108 GPKRCTTCNKRVGLTGFNC-RCGN  130 (171)
Q Consensus       108 ~~~rC~~C~kkvgl~gf~C-rCg~  130 (171)
                      .-.||..||| +| ..|.| .||.
T Consensus        37 ~I~Rc~~CRk-~g-~~Y~Cp~CGF   58 (61)
T COG2888          37 EIYRCAKCRK-LG-NPYRCPKCGF   58 (61)
T ss_pred             eeehhhhHHH-cC-CceECCCcCc
Confidence            3578888885 22 24788 5775


No 74 
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=23.12  E-value=42  Score=34.31  Aligned_cols=45  Identities=29%  Similarity=0.836  Sum_probs=30.6

Q ss_pred             CCCCCCCccccccccc--------------cccceeee-cCccccC---------CCCCC----CCCCCCccc
Q 030779          104 KAKEGPKRCTTCNKRV--------------GLTGFNCR-CGNLFCA---------VHRYS----DKHGCPFDY  148 (171)
Q Consensus       104 ~~~~~~~rC~~C~kkv--------------gl~gf~Cr-Cg~~FC~---------~HRy~----e~H~C~fDy  148 (171)
                      .+...+|.|-.|.|-|              |-..|+|+ ||+-|--         .||-.    -.|.|.+-|
T Consensus       600 ~~~TdPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~  672 (958)
T KOG1074|consen  600 NKRTDPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTF  672 (958)
T ss_pred             cccCCccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchh
Confidence            3445789999998744              33369999 9999973         34432    567787544


No 75 
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway. Domain is involved in recognition of N-end rule substrates in yeast Ubr1p
Probab=22.89  E-value=46  Score=23.20  Aligned_cols=14  Identities=36%  Similarity=0.850  Sum_probs=11.9

Q ss_pred             ceeeecCcc-------ccCCC
Q 030779          123 GFNCRCGNL-------FCAVH  136 (171)
Q Consensus       123 gf~CrCg~~-------FC~~H  136 (171)
                      ||.|-||..       ||..|
T Consensus        50 ~~~CDCG~~~~~~~~~~C~~h   70 (71)
T smart00396       50 SGICDCGDKEAWNEDLKCKAH   70 (71)
T ss_pred             CEEECCCChhccCCCcccccc
Confidence            389999988       88887


No 76 
>PTZ00218 40S ribosomal protein S29; Provisional
Probab=21.97  E-value=54  Score=22.37  Aligned_cols=13  Identities=23%  Similarity=0.751  Sum_probs=11.0

Q ss_pred             CCchhHHHHHHHH
Q 030779           31 MNMCSKCHKAMIL   43 (171)
Q Consensus        31 ~n~CSkCyr~~~~   43 (171)
                      .|||..|||+...
T Consensus        34 L~~CRqCFRe~A~   46 (54)
T PTZ00218         34 LNVCRQCFRENAE   46 (54)
T ss_pred             cchhhHHHHHhhH
Confidence            5799999999854


No 77 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=21.09  E-value=47  Score=19.79  Aligned_cols=12  Identities=33%  Similarity=1.016  Sum_probs=7.2

Q ss_pred             cceeee-cCcccc
Q 030779          122 TGFNCR-CGNLFC  133 (171)
Q Consensus       122 ~gf~Cr-Cg~~FC  133 (171)
                      -.|+|. ||..|=
T Consensus         4 Y~y~C~~Cg~~fe   16 (41)
T smart00834        4 YEYRCEDCGHTFE   16 (41)
T ss_pred             EEEEcCCCCCEEE
Confidence            356666 666554


No 78 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=20.82  E-value=46  Score=19.96  Aligned_cols=23  Identities=26%  Similarity=0.664  Sum_probs=12.3

Q ss_pred             cccccccccccceeeecCccccC
Q 030779          112 CTTCNKRVGLTGFNCRCGNLFCA  134 (171)
Q Consensus       112 C~~C~kkvgl~gf~CrCg~~FC~  134 (171)
                      |..|...+.-.-..-.||++||.
T Consensus         1 C~iC~~~~~~~~~~~~CGH~fC~   23 (39)
T PF13923_consen    1 CPICLDELRDPVVVTPCGHSFCK   23 (39)
T ss_dssp             ETTTTSB-SSEEEECTTSEEEEH
T ss_pred             CCCCCCcccCcCEECCCCCchhH
Confidence            34454433332245569999985


No 79 
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=20.20  E-value=37  Score=25.76  Aligned_cols=13  Identities=31%  Similarity=0.695  Sum_probs=8.6

Q ss_pred             cceeee-cCccccC
Q 030779          122 TGFNCR-CGNLFCA  134 (171)
Q Consensus       122 ~gf~Cr-Cg~~FC~  134 (171)
                      ..-.|| ||++|=.
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            356777 7777744


No 80 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=20.18  E-value=70  Score=21.36  Aligned_cols=23  Identities=30%  Similarity=0.774  Sum_probs=16.8

Q ss_pred             CCccccccccccc--c--ceeee-cCcc
Q 030779          109 PKRCTTCNKRVGL--T--GFNCR-CGNL  131 (171)
Q Consensus       109 ~~rC~~C~kkvgl--~--gf~Cr-Cg~~  131 (171)
                      ...|..|+.++.-  .  .|.|. ||..
T Consensus        28 Sq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   28 SQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             ccCccCcccccccccccceEEcCCCCCE
Confidence            4579999888776  2  58888 7655


No 81 
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=20.13  E-value=98  Score=17.60  Aligned_cols=20  Identities=20%  Similarity=0.668  Sum_probs=12.8

Q ss_pred             ceeeecCccccCCCCCCCCCCCC
Q 030779          123 GFNCRCGNLFCAVHRYSDKHGCP  145 (171)
Q Consensus       123 gf~CrCg~~FC~~HRy~e~H~C~  145 (171)
                      +|.|.|..-|   ..-++.|.|.
T Consensus         1 sy~C~C~~Gy---~l~~d~~~C~   20 (24)
T PF12662_consen    1 SYTCSCPPGY---QLSPDGRSCE   20 (24)
T ss_pred             CEEeeCCCCC---cCCCCCCccc
Confidence            5889986544   3345677774


No 82 
>PF11722 zf-TRM13_CCCH:  CCCH zinc finger in TRM13 protein;  InterPro: IPR021721  This domain is found at the N terminus of TRM13 methyltransferase proteins. It is presumed to be a zinc binding domain. ; GO: 0008168 methyltransferase activity
Probab=20.09  E-value=44  Score=20.10  Aligned_cols=11  Identities=36%  Similarity=0.797  Sum_probs=8.3

Q ss_pred             ecCccccCCCC
Q 030779          127 RCGNLFCAVHR  137 (171)
Q Consensus       127 rCg~~FC~~HR  137 (171)
                      +=|..||+.|.
T Consensus        20 ~~g~~fC~~H~   30 (31)
T PF11722_consen   20 KPGSRFCGEHM   30 (31)
T ss_pred             cCcCCccccCC
Confidence            44678999985


Done!