Citrus Sinensis ID: 030779


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MESHDETGCQAPEGPILCVNNCGFFGSAATMNMCSKCHKAMILNQEQAQLAASSIGSIVHGSSGGTGKEPIVAGSVDLQVGPVEIKKFSMEPSSGSSFGFAGVKAKEGPKRCTTCNKRVGLTGFNCRCGNLFCAVHRYSDKHGCPFDYRTAAREAIAKANPVVKAEKLDKI
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHcccccccccccc
*************GPILCVNNCGFFGSAATMNMCSKCHKAMILNQEQ***********************************************************EGPKRCTTCNKRVGLTGFNCRCGNLFCAVHRYSDKHGCPFDYRTAAREAIAKANPVVKAEKLDKI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESHDETGCQAPEGPILCVNNCGFFGSAATMNMCSKCHKAMILNQEQAQLAASSIGSIVHGSSGGTGKEPIVAGSVDLQVGPVEIKKFSMEPSSGSSFGFAGVKAKEGPKRCTTCNKRVGLTGFNCRCGNLFCAVHRYSDKHGCPFDYRTAAREAIAKANPVVKAEKLDKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger A20 and AN1 domain-containing stress-associated protein 8 May be involved in environmental stress response.confidentA3BDI8
Zinc finger A20 and AN1 domain-containing stress-associated protein 8 May be involved in environmental stress response.probableA2YEZ6
Zinc finger A20 and AN1 domain-containing stress-associated protein 2 May be involved in environmental stress response.probableQ8H0X0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WFF, chain A
Confidence level:very confident
Coverage over the Query: 105-166
View the alignment between query and template
View the model in PyMOL
Template: 2C7N, chain A
Confidence level:confident
Coverage over the Query: 17-46
View the alignment between query and template
View the model in PyMOL