BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 030780
         (171 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1OBB|A Chain A, Alpha-Glucosidase A, Agla, From Thermotoga Maritima In
           Complex With Maltose And Nad+
 pdb|1OBB|B Chain B, Alpha-Glucosidase A, Agla, From Thermotoga Maritima In
           Complex With Maltose And Nad+
          Length = 480

 Score = 27.7 bits (60), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 125 SRPDDILTAAEKYMEENGTD-AFEKLIHRAD 154
            R D ILT A+KY+EE G D  FEK ++  D
Sbjct: 43  ERLDAILTIAKKYVEEVGADLKFEKTMNLDD 73


>pdb|3BBO|D Chain D, Homology Model For The Spinach Chloroplast 50s Subunit
           Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
          Length = 352

 Score = 27.3 bits (59), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 26  LVYPLYASVRAIETKSPTDDRQ--WLTYWILYSMITLVELTFAKVIEWIP 73
           L+  L+A+++++ET  PT  +   W +  I  SM   + L   +++++ P
Sbjct: 299 LLINLFATIKSVETNKPTGAKGVYWKSAHISSSMGPSIRLNIREMLDYKP 348


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.138    0.441 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,587,972
Number of Sequences: 62578
Number of extensions: 230376
Number of successful extensions: 380
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 369
Number of HSP's gapped (non-prelim): 13
length of query: 171
length of database: 14,973,337
effective HSP length: 92
effective length of query: 79
effective length of database: 9,216,161
effective search space: 728076719
effective search space used: 728076719
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)