Citrus Sinensis ID: 030784

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MASVSSSSSSSSCFTSAHFAIPRVSSFPSHTPNKLSFPSHFYAKNATFKAPNRSLSLKVLCVRESRAVVTKDSWEKSILNSDTPVLVEFYASWCGPCRMVHRVIDEIAGEYAGRLRCFMVNTDTDLTIAEDYEIKAVPVVLLFKNGEKRETVVGTMPKEFYIAAIERVLKS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccEEECccccHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHcccccccEEEEEEccEEEEEEEccccHHHHHHHHHHHHcc
******************FAI***************FPSHFYAKNATFKAPNRSLSLKVLCVRESRAVVTKDSWEKSILNSDTPVLVEFYASWCGPCRMVHRVIDEIAGEYAGRLRCFMVNTDTDLTIAEDYEIKAVPVVLLFKNGEKRETVVGTMPKEFYIAAIERVLK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASVSSSSSSSSCFTSAHFAIPRVSSFPSHTPNKLSFPSHFYAKNATFKAPNRSLSLKVLCVRESRAVVTKDSWEKSILNSDTPVLVEFYASWCGPCRMVHRVIDEIAGEYAGRLRCFMVNTDTDLTIAEDYEIKAVPVVLLFKNGEKRETVVGTMPKEFYIAAIERVLKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin M3, chloroplastic Thiol-disulfide oxidoreductase required for maintaining symplastic permeability in the meristem. Involved in redox regulation of callose deposition, plasmodesmata cell-to-cell communication and meristem maintenance.probableQ9SEU7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 64-170
View the alignment between query and template
View the model in PyMOL