Query         030789
Match_columns 171
No_of_seqs    35 out of 37
Neff          2.1 
Searched_HMMs 46136
Date          Fri Mar 29 04:36:12 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030789.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030789hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00014 light-harvesting-like 100.0 4.9E-62 1.1E-66  412.3  10.0  165    4-170     1-170 (250)
  2 PHA02337 putative high light i  89.3   0.093   2E-06   34.1  -0.3   11  160-170     3-13  (35)
  3 PF14963 CAML:  Calcium signal-  64.0     3.1 6.7E-05   36.9   0.9   12  119-130     6-17  (263)
  4 PF10999 DUF2839:  Protein of u  45.2      12 0.00025   27.2   1.1   24  121-151     3-26  (68)
  5 PF09782 NDUF_B6:  NADH:ubiquin  38.0      20 0.00043   29.4   1.5   21  122-144    29-49  (156)
  6 PF14114 DUF4286:  Domain of un  34.8      19 0.00041   26.2   0.9   17  149-165    15-31  (98)
  7 PF05071 NDUFA12:  NADH ubiquin  34.3     7.6 0.00016   28.9  -1.3   48  110-164    10-61  (105)
  8 PF00504 Chloroa_b-bind:  Chlor  32.9      10 0.00022   28.8  -0.8   14  157-170   131-144 (156)
  9 COG4019 Uncharacterized protei  28.4      28  0.0006   29.0   0.9   14  153-166    55-68  (156)
 10 PF06543 Lac_bphage_repr:  Lact  26.4      36 0.00078   23.8   1.1   21   98-118     4-24  (49)
 11 PRK08183 NADH dehydrogenase; V  26.0      20 0.00043   28.7  -0.3   36  121-165    48-87  (133)
 12 PF05400 FliT:  Flagellar prote  24.7      49  0.0011   21.7   1.5   19  112-130     8-26  (84)
 13 PF12244 DUF3606:  Protein of u  24.6      43 0.00093   22.7   1.2   14  152-165    25-38  (57)
 14 PRK10548 flagellar biosynthesi  23.8      51  0.0011   25.5   1.6   19  112-130    28-46  (121)
 15 PRK06630 hypothetical protein;  23.2      21 0.00045   27.9  -0.7   26  122-156    35-62  (99)
 16 PF08557 Lipid_DES:  Sphingolip  22.8      36 0.00078   22.5   0.5   14  121-134    16-29  (39)
 17 PF14078 DUF4259:  Domain of un  21.4      21 0.00047   25.9  -0.9   20   99-118     1-20  (128)
 18 PF09701 Cas_Cmr5:  CRISPR-asso  20.6      52  0.0011   24.5   1.0   11  147-157   107-117 (122)
 19 PLN03182 xyloglucan 6-xylosylt  20.1      94   0.002   29.5   2.8   31  111-147   102-135 (429)

No 1  
>PLN00014 light-harvesting-like protein 3; Provisional
Probab=100.00  E-value=4.9e-62  Score=412.28  Aligned_cols=165  Identities=46%  Similarity=0.829  Sum_probs=131.5

Q ss_pred             cccccccCCCCCCC-ccCCccccccCcceeecCCC-ccchhhhhccccCCCccC-CCcccccCCCccc--CCCCCCCCCC
Q 030789            4 SIDLLSFSPPPSSM-LSRTQFSFTHKPTFLLSSKK-ESFFTLRASAADNGAGVS-APAVTVEEPKVRE--ASEGPTESNG   78 (171)
Q Consensus         4 s~~ma~FSPp~~~~-~~~p~~~~~~k~~~~L~~~~-~~l~~~~ras~dnga~~s-a~a~~VE~Pkp~~--a~~~~~~sng   78 (171)
                      +|+|++++++.+++ +++|+  ..+++..+|.+++ .+++...+++++++..++ .++..++.++...  ++-...+..+
T Consensus         1 ~~~~sl~~~~~~~~~~~k~~--~~~r~~~~l~~~~~~~~~~~~~~~~~~~~~~~r~~~pl~~gg~l~g~~a~gk~~~~aa   78 (250)
T PLN00014          1 MISMSLSRASSSTLVVSKPN--PQSRSSRSLGAKSEGSLVSVTVASTDGGGISERKPSPLERGGTLEGEAAAGKDPGPAA   78 (250)
T ss_pred             CcccccCCCccccccccCCC--cccccccccccccccceEEEeecccCCCCccccCCCccccCCCcccccccccCccccc
Confidence            36778888776665 46888  8899999999999 889999999999875333 2333444443221  1111111112


Q ss_pred             cccCcccccCCCccCCccccCccchhhhhhcCCcCchhhhhHHHHHhhhhhcCCCCCCCCCCeeeecCcchHHHHHHhhc
Q 030789           79 AVEAPEVKAVNKFEDPKWVNGTWDLKQFQKNGQTDWDAVIDAEARRRKWLENSPESSSNDDPVIFDTSIVPWWAWIKRFH  158 (171)
Q Consensus        79 A~~~~e~~~~~~f~D~RW~~GtWDl~qF~~~G~~dWDaVIdAE~~rRK~Led~Pe~s~n~epv~FdtsiiPWWaW~kRfh  158 (171)
                      ++......+.++|+||||+||||||+||++||+||||+||||||+||||||||||+|+||||||||||||||||||||||
T Consensus        79 ~~~~~~~~~~~~f~d~RW~~GtWDl~qF~~dG~~DWd~vIdaEv~rRK~LE~nPe~s~n~epv~FdtSiiPWWaW~~rf~  158 (250)
T PLN00014         79 AAKTSLAVSVGKFEDPRWKNGTWDLNQFKKDGKTDWDAVIDAEVVRRKWLEDNPETSSNDEPVLFDTSIIPWWAWVKRFH  158 (250)
T ss_pred             ccccccccccccccCchhcCCcccHHHHhhcCCcchHHHHHHHHHHHHHHhhCccccCCCCCceeecccccHHHHHHhcc
Confidence            23333344689999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CchhhhhccccC
Q 030789          159 LPEAELLNGAAL  170 (171)
Q Consensus       159 LPEAE~lNGRAA  170 (171)
                      ||+||++|||+|
T Consensus       159 l~~aE~lNGR~A  170 (250)
T PLN00014        159 LPEAELLNGRAA  170 (250)
T ss_pred             CchhHhhhhHHH
Confidence            999999999997


No 2  
>PHA02337 putative high light inducible protein
Probab=89.32  E-value=0.093  Score=34.08  Aligned_cols=11  Identities=55%  Similarity=0.800  Sum_probs=10.0

Q ss_pred             chhhhhccccC
Q 030789          160 PEAELLNGAAL  170 (171)
Q Consensus       160 PEAE~lNGRAA  170 (171)
                      |.||++|||+|
T Consensus         3 ~~aE~~NGRlA   13 (35)
T PHA02337          3 PEAEIFNGWLA   13 (35)
T ss_pred             cHHHHHhhHHH
Confidence            68999999987


No 3  
>PF14963 CAML:  Calcium signal-modulating cyclophilin ligand
Probab=64.05  E-value=3.1  Score=36.91  Aligned_cols=12  Identities=75%  Similarity=0.847  Sum_probs=10.6

Q ss_pred             hHHHHHhhhhhc
Q 030789          119 DAEARRRKWLEN  130 (171)
Q Consensus       119 dAE~~rRK~Led  130 (171)
                      -||+||||+|+.
T Consensus         6 RaEaRRRKLLmN   17 (263)
T PF14963_consen    6 RAEARRRKLLMN   17 (263)
T ss_pred             HHHHHHHHHHhh
Confidence            489999999985


No 4  
>PF10999 DUF2839:  Protein of unknown function (DUF2839);  InterPro: IPR021262  This bacterial family of unknown function appear to be restricted to Cyanobacteria. 
Probab=45.24  E-value=12  Score=27.17  Aligned_cols=24  Identities=42%  Similarity=0.778  Sum_probs=15.5

Q ss_pred             HHHHhhhhhcCCCCCCCCCCeeeecCcchHH
Q 030789          121 EARRRKWLENSPESSSNDDPVIFDTSIVPWW  151 (171)
Q Consensus       121 E~~rRK~Led~Pe~s~n~epv~FdtsiiPWW  151 (171)
                      |++|||=+-..|.. .+++.      |+||=
T Consensus         3 EAKRRke~Gl~pr~-~k~~~------~~~wl   26 (68)
T PF10999_consen    3 EAKRRKELGLPPRY-KKEER------ILPWL   26 (68)
T ss_pred             chhhhhhccCCCcc-CCccc------ccccC
Confidence            99999987554443 33343      77774


No 5  
>PF09782 NDUF_B6:  NADH:ubiquinone oxidoreductase, NDUFB6/B17 subunit;  InterPro: IPR019174  The NADH dehydrogenase [ubiquinone] complex performs the first stage of electron transfer from NADH to the respiratory chain. This entry represents an accessory subunit that is not thought to be involved in catalysis [].
Probab=38.05  E-value=20  Score=29.42  Aligned_cols=21  Identities=38%  Similarity=0.708  Sum_probs=16.0

Q ss_pred             HHHhhhhhcCCCCCCCCCCeeee
Q 030789          122 ARRRKWLENSPESSSNDDPVIFD  144 (171)
Q Consensus       122 ~~rRK~Led~Pe~s~n~epv~Fd  144 (171)
                      +-|||||.|-  --+-+|||+-.
T Consensus        29 a~Rr~WLkDQ--~Lsp~EPv~~p   49 (156)
T PF09782_consen   29 AWRRQWLKDQ--ELSPREPVLPP   49 (156)
T ss_pred             HHHHHHHHhh--ccCCCCCcCCc
Confidence            5699999995  34567999765


No 6  
>PF14114 DUF4286:  Domain of unknown function (DUF4286)
Probab=34.84  E-value=19  Score=26.24  Aligned_cols=17  Identities=35%  Similarity=0.860  Sum_probs=14.3

Q ss_pred             hHHHHHHhhcCchhhhh
Q 030789          149 PWWAWIKRFHLPEAELL  165 (171)
Q Consensus       149 PWWaW~kRfhLPEAE~l  165 (171)
                      -|=.|||..|+|+....
T Consensus        15 ~wl~W~k~~hIp~vl~~   31 (98)
T PF14114_consen   15 EWLNWMKEEHIPEVLAT   31 (98)
T ss_pred             HHHHHHHHHHHHHHHhc
Confidence            37799999999998654


No 7  
>PF05071 NDUFA12:  NADH ubiquinone oxidoreductase subunit NDUFA12;  InterPro: IPR007763  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. this entry represents the 17.2kDa subunit from NADH:ubiquinone oxidoreductase and its homologues []. This subunit is believed to be one of the 36 structural complex I proteins.; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0009055 electron carrier activity, 0016020 membrane
Probab=34.33  E-value=7.6  Score=28.94  Aligned_cols=48  Identities=35%  Similarity=0.756  Sum_probs=31.6

Q ss_pred             CCcCchhhhhHHHHHhhhhhcCCCCCCCCCCeeeecCcch--HHHHHH--hhcCchhhh
Q 030789          110 GQTDWDAVIDAEARRRKWLENSPESSSNDDPVIFDTSIVP--WWAWIK--RFHLPEAEL  164 (171)
Q Consensus       110 G~~dWDaVIdAE~~rRK~Led~Pe~s~n~epv~FdtsiiP--WWaW~k--RfhLPEAE~  164 (171)
                      |..=|..-.+..-+||+|.+-+...       -||.|.||  |.+||+  |-+.|-.|.
T Consensus        10 GN~YyE~~~~~~~~~rRwV~y~~~~-------~~~~s~IPpeWh~WL~~~r~~pPt~~~   61 (105)
T PF05071_consen   10 GNKYYENPRDEQGRRRRWVEYAGKS-------DYDPSQIPPEWHAWLHHTRDEPPTEEE   61 (105)
T ss_pred             CCEEEeecCCCcCCCcEEEEcCCcc-------ccCcCccCcchHHHhccCcCCCCCccc
Confidence            4444444456677888898765443       46677887  999996  556665443


No 8  
>PF00504 Chloroa_b-bind:  Chlorophyll A-B binding protein;  InterPro: IPR022796 The light-harvesting complex (LHC) consists of chlorophylls A and B and the chlorophyll A-B binding protein. LHC functions as a light receptor that captures and delivers excitation energy to photosystems I and II with which it is closely associated. Under changing light conditions, the reversible phosphorylation of light harvesting chlorophyll a/b binding proteins (LHCII) represents a system for balancing the excitation energy between the two photosystems []. The N terminus of the chlorophyll A-B binding protein extends into the stroma where it is involved with adhesion of granal membranes and photo-regulated by reversible phosphorylation of its threonine residues []. Both these processes are believed to mediate the distribution of excitation energy between photosystems I and II. This family also includes the photosystem II protein PsbS, which plays a role in energy-dependent quenching that increases thermal dissipation of excess absorbed light energy in the photosystem [].; PDB: 2O01_2 2WSF_2 2WSC_2 3LW5_2 2WSE_2 1RWT_D 2BHW_C 1VCR_A.
Probab=32.94  E-value=10  Score=28.81  Aligned_cols=14  Identities=36%  Similarity=0.266  Sum_probs=11.4

Q ss_pred             hcCchhhhhccccC
Q 030789          157 FHLPEAELLNGAAL  170 (171)
Q Consensus       157 fhLPEAE~lNGRAA  170 (171)
                      .....+|+.|||.|
T Consensus       131 ~~~~~~El~NGRlA  144 (156)
T PF00504_consen  131 EFMQLAELKNGRLA  144 (156)
T ss_dssp             HCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            44568999999987


No 9  
>COG4019 Uncharacterized protein conserved in archaea [Function unknown]
Probab=28.39  E-value=28  Score=29.01  Aligned_cols=14  Identities=50%  Similarity=0.861  Sum_probs=12.0

Q ss_pred             HHHhhcCchhhhhc
Q 030789          153 WIKRFHLPEAELLN  166 (171)
Q Consensus       153 W~kRfhLPEAE~lN  166 (171)
                      =|+||.|||||.|.
T Consensus        55 vlrrf~l~Eaeml~   68 (156)
T COG4019          55 VLRRFCLAEAEMLD   68 (156)
T ss_pred             HHHHhccchHHHhc
Confidence            48999999999873


No 10 
>PF06543 Lac_bphage_repr:  Lactococcus bacteriophage repressor;  InterPro: IPR009498 This entry represents the C terminus of various Lactococcus bacteriophage repressor proteins.
Probab=26.40  E-value=36  Score=23.78  Aligned_cols=21  Identities=29%  Similarity=0.593  Sum_probs=17.7

Q ss_pred             cCccchhhhhhcCCcCchhhh
Q 030789           98 NGTWDLKQFQKNGQTDWDAVI  118 (171)
Q Consensus        98 ~GtWDl~qF~~~G~~dWDaVI  118 (171)
                      |-.-||..+..|.++|||-++
T Consensus         4 ~epiDLa~lvDd~kvdWd~wv   24 (49)
T PF06543_consen    4 NEPIDLADLVDDPKVDWDKWV   24 (49)
T ss_pred             cCcccHHHHcCCcccchHHhe
Confidence            456799999999999999875


No 11 
>PRK08183 NADH dehydrogenase; Validated
Probab=25.96  E-value=20  Score=28.66  Aligned_cols=36  Identities=25%  Similarity=0.643  Sum_probs=24.8

Q ss_pred             HHHHhhhhhcCCCCCCCCCCeeeecCcch--HHHHHHh--hcCchhhhh
Q 030789          121 EARRRKWLENSPESSSNDDPVIFDTSIVP--WWAWIKR--FHLPEAELL  165 (171)
Q Consensus       121 E~~rRK~Led~Pe~s~n~epv~FdtsiiP--WWaW~kR--fhLPEAE~l  165 (171)
                      .-+||+|.+-+-         .+|.|.||  |.+||..  -+.|..|.+
T Consensus        48 ~~~~rRWV~Y~~---------~~d~s~IPpeWh~WLh~~~d~pPt~~~~   87 (133)
T PRK08183         48 DGRERRWVIYNG---------YAEASRIPPEWHGWLHHTVDVPPTKEPY   87 (133)
T ss_pred             CCCceEEEEeCC---------CCCccccCchHHhhhccCcCCCCCcccc
Confidence            467888988432         25778897  9999964  366765544


No 12 
>PF05400 FliT:  Flagellar protein FliT;  InterPro: IPR008622 This entry represents the bacterial flagellar FliT family of dual-function proteins. Together with FlgN, FliT has been proposed to act as a substrate-specific export chaperone, facilitating the incorporation of the enterobacterial hook-associated axial proteins (HAPs) FlgK/FlgL and FliD into the growing flagellum []. FliT has also been shown to act as a transcriptional regulator in Salmonella typhimurium [].; GO: 0019861 flagellum; PDB: 3A7M_A 3H3M_B 3NKZ_C 2G42_A 2FZT_B.
Probab=24.73  E-value=49  Score=21.66  Aligned_cols=19  Identities=26%  Similarity=0.580  Sum_probs=15.8

Q ss_pred             cCchhhhhHHHHHhhhhhc
Q 030789          112 TDWDAVIDAEARRRKWLEN  130 (171)
Q Consensus       112 ~dWDaVIdAE~~rRK~Led  130 (171)
                      =|||.|+.-+..|...++.
T Consensus         8 ~dWe~l~~l~~~R~~ll~~   26 (84)
T PF05400_consen    8 GDWEELEELLDERQELLER   26 (84)
T ss_dssp             T-HHHHHHHHHHHHHHHHH
T ss_pred             CcHHHHHHHHHHHHHHHHH
Confidence            3899999999999999853


No 13 
>PF12244 DUF3606:  Protein of unknown function (DUF3606);  InterPro: IPR022037  This family of proteins is found in bacteria. Proteins in this family are typically between 58 and 85 amino acids in length. There is a single completely conserved residue G that may be functionally important. 
Probab=24.60  E-value=43  Score=22.70  Aligned_cols=14  Identities=43%  Similarity=0.802  Sum_probs=12.0

Q ss_pred             HHHHhhcCchhhhh
Q 030789          152 AWIKRFHLPEAELL  165 (171)
Q Consensus       152 aW~kRfhLPEAE~l  165 (171)
                      -|.|+|+++++++.
T Consensus        25 ywa~~~gvt~~~L~   38 (57)
T PF12244_consen   25 YWAKRFGVTEEQLR   38 (57)
T ss_pred             HHHHHHCcCHHHHH
Confidence            48899999999875


No 14 
>PRK10548 flagellar biosynthesis protein FliT; Provisional
Probab=23.81  E-value=51  Score=25.52  Aligned_cols=19  Identities=26%  Similarity=0.536  Sum_probs=16.7

Q ss_pred             cCchhhhhHHHHHhhhhhc
Q 030789          112 TDWDAVIDAEARRRKWLEN  130 (171)
Q Consensus       112 ~dWDaVIdAE~~rRK~Led  130 (171)
                      =|||.||+.|..-.+.+|.
T Consensus        28 g~Wd~Li~lE~~y~~~Ve~   46 (121)
T PRK10548         28 GQWDELIEQEVAYVQAVEE   46 (121)
T ss_pred             CCHHHHHHHHHHHHHHHHH
Confidence            4899999999999988873


No 15 
>PRK06630 hypothetical protein; Provisional
Probab=23.21  E-value=21  Score=27.86  Aligned_cols=26  Identities=23%  Similarity=0.758  Sum_probs=19.3

Q ss_pred             HHHhhhhhcCCCCCCCCCCeeeecCcch--HHHHHHh
Q 030789          122 ARRRKWLENSPESSSNDDPVIFDTSIVP--WWAWIKR  156 (171)
Q Consensus       122 ~~rRK~Led~Pe~s~n~epv~FdtsiiP--WWaW~kR  156 (171)
                      -+||+|.+-+-         .+|.|-||  |+.||-.
T Consensus        35 gr~rRWViY~g---------~~daS~VPpeWHgWLHh   62 (99)
T PRK06630         35 GRPRRFVIYKN---------VNEPTKIPPSWHAWLHH   62 (99)
T ss_pred             CCceEEEEeCC---------CCccccCCcchhhhhcc
Confidence            35678887643         36789998  9999954


No 16 
>PF08557 Lipid_DES:  Sphingolipid Delta4-desaturase (DES);  InterPro: IPR013866  Sphingolipids are important membrane signalling molecules involved in many different cellular functions in eukaryotes. Sphingolipid delta 4-desaturase catalyses the formation of (E)-sphing-4-enine []. Some proteins in this entry have bifunctional delta 4-desaturase/C-4-hydroxylase activity. Delta 4-desaturated sphingolipids may play a role in early signalling required for entry into meiotic and spermatid differentiation pathways during Drosophila spermatogenesis []. This small protein associates with FA_desaturase IPR005804 from INTERPRO and appears to be specific to sphingolipid delta 4-desaturase. ; GO: 0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 0006633 fatty acid biosynthetic process, 0055114 oxidation-reduction process, 0016021 integral to membrane
Probab=22.81  E-value=36  Score=22.48  Aligned_cols=14  Identities=36%  Similarity=0.662  Sum_probs=11.7

Q ss_pred             HHHHhhhhhcCCCC
Q 030789          121 EARRRKWLENSPES  134 (171)
Q Consensus       121 E~~rRK~Led~Pe~  134 (171)
                      -.|||.+|+.+||.
T Consensus        16 ~~RRk~IL~k~PeI   29 (39)
T PF08557_consen   16 ASRRKEILKKHPEI   29 (39)
T ss_pred             HHHHHHHHHhChHH
Confidence            36899999999984


No 17 
>PF14078 DUF4259:  Domain of unknown function (DUF4259)
Probab=21.40  E-value=21  Score=25.93  Aligned_cols=20  Identities=20%  Similarity=0.536  Sum_probs=17.4

Q ss_pred             CccchhhhhhcCCcCchhhh
Q 030789           99 GTWDLKQFQKNGQTDWDAVI  118 (171)
Q Consensus        99 GtWDl~qF~~~G~~dWDaVI  118 (171)
                      |+|+..-|..|+..||=.-+
T Consensus         1 GaWg~g~FdnD~a~D~l~el   20 (128)
T PF14078_consen    1 GAWGTGPFDNDTALDFLDEL   20 (128)
T ss_pred             CCCCCCCCCCchHHHHHHHH
Confidence            89999999999999995544


No 18 
>PF09701 Cas_Cmr5:  CRISPR-associated protein (Cas_Cmr5);  InterPro: IPR010160 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a family of Cas proteins as represented by TM1791.1 from Thermotoga maritima. This family of Cas proteins are found in both archaeal and bacterial species.; PDB: 2OEB_A 2ZOP_A.
Probab=20.58  E-value=52  Score=24.55  Aligned_cols=11  Identities=36%  Similarity=1.084  Sum_probs=9.2

Q ss_pred             cchHHHHHHhh
Q 030789          147 IVPWWAWIKRF  157 (171)
Q Consensus       147 iiPWWaW~kRf  157 (171)
                      ++-++.|+|||
T Consensus       107 ~La~l~WlKRf  117 (122)
T PF09701_consen  107 ALAFLNWLKRF  117 (122)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
Confidence            46789999998


No 19 
>PLN03182 xyloglucan 6-xylosyltransferase; Provisional
Probab=20.13  E-value=94  Score=29.47  Aligned_cols=31  Identities=35%  Similarity=0.709  Sum_probs=22.0

Q ss_pred             CcCchhhhhHHHHHhhhhhcCCCCCCC---CCCeeeecCc
Q 030789          111 QTDWDAVIDAEARRRKWLENSPESSSN---DDPVIFDTSI  147 (171)
Q Consensus       111 ~~dWDaVIdAE~~rRK~Led~Pe~s~n---~epv~Fdtsi  147 (171)
                      -+|||      .+|+.||+.||.....   ..+||.=|..
T Consensus       102 i~~wd------~~R~~wl~~~p~~~~~~~g~prVviVT~s  135 (429)
T PLN03182        102 ISDWD------EQRRRWLRKNPGFPSFVNGKPRVLLVTGS  135 (429)
T ss_pred             CCCHH------HHHHHHHHhCCCCCCccCCCCCEEEEeCC
Confidence            46787      5899999999997643   3456655543


Done!