Citrus Sinensis ID: 030804

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MAAGASSVWMLNQSSFLGSCQQLSSVSKLVASRRPRPAPPSLFIVEASTRPRTKREDRTARHSRIRKKIDGTPERPRLCVFRSNKHLYVQVIDDTKMHTLASASTMQKPISEELDYSSGPTIEVSKKVGEMIAKSCLEKGITKVAFDRGGYPYHGRIQALADAAREYGLQF
cccccccHHHHccccccccccccccHHHHccccccccccccEEEEEEEEccccHHHHHHHHHHHHHccccccccccCEEEEEccccEEEEEEEcccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHccccc
**********LNQSSFL*********************************************SRIRKKIDGTPERPRLCVFRSNKHLYVQVIDDTKMHTLASASTMQKP*************EVSKKVGEMIAKSCLEKGITKVAFDRGGYPYHGRIQALADAAREYGLQF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAGASSVWMLNQSSFLGSCQQLSSVSKLVASRRPRPAPPSLFIVEASTRPRTKREDRTARHSRIRKKIDGTPERPRLCVFRSNKHLYVQVIDDTKMHTLASASTMQKPISEELDYSSGPTIEVSKKVGEMIAKSCLEKGITKVAFDRGGYPYHGRIQALADAAREYGLQF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L18, chloroplastic Binds 5S rRNA, forms part of the central protuberance of the 50S subunit.probableQ9SX68
50S ribosomal protein L18 This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance.probableQ9Z9J8
50S ribosomal protein L18 This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance.probableB7HJ64

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain Q
Confidence level:very confident
Coverage over the Query: 49-171
View the alignment between query and template
View the model in PyMOL