Citrus Sinensis ID: 030815


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MAEAKKQKHFVLVHGSNHGAWCWYKVKPQLEAAGHRVTALDLTASGIDMKKIQDVHSFYEYNEPLLEILASLSADEKVVIVGHSLGGLSLALAAEKFPHKISVAIFLTAFMPDTKHQPSYVVERFFERIPSGEWLDTQFSVIDSSNPSRKTLFFGYSFLTLKLYQLSPPEV
ccccccccEEEEEcccccccccHHHHHHHHHcccccEEEccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHccccccEEEEECccccccccccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHccccccc
*****KQ*HFVLVHGSNHGAWCWYKVKPQLEAAGHRVTALDLTASGIDMKKIQDVHSFYEYNEPLLEILASLSADEKVVIVGHSLGGLSLALAAEKFPHKISVAIFLTAFMPDTKHQPSYVVERFFERIPSGEWLDTQFSVIDSSNPSRKTLFFGYSFLTLKLYQLSPP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEAKKQKHFVLVHGSNHGAWCWYKVKPQLEAAGHRVTALDLTASGIDMKKIQDVHSFYEYNEPLLEILASLSADEKVVIVGHSLGGLSLALAAEKFPHKISVAIFLTAFMPDTKHQPSYVVERFFERIPSGEWLDTQFSVIDSSNPSRKTLFFGYSFLTLKLYQLSPPEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Methylesterase 1 Methylesterase shown to have carboxylesterase activity, methyl indole-3-acetic acid (MeIAA) esterase activity, methyl salicylate (MeSA) esterase activity and methyl jasmonate (MeJA) esterase activity in vitro. Required to convert methyl salicylate (MeSA) to salicylic acid (SA) as part of the signal transduction pathways that activate systemic acquired resistance in systemic tissue. MeSA is believed to be an inactive form that needs to be demethylated to exert a biological effect.probableQ8S8S9

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XKL, chain A
Confidence level:very confident
Coverage over the Query: 6-115
View the alignment between query and template
View the model in PyMOL
Template: 3STY, chain A
Confidence level:very confident
Coverage over the Query: 5-168
View the alignment between query and template
View the model in PyMOL