Query         030821
Match_columns 171
No_of_seqs    14 out of 16
Neff          2.1 
Searched_HMMs 46136
Date          Fri Mar 29 05:04:50 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/030821.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/030821hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08370 PDR_assoc:  Plant PDR   76.2     2.8 6.1E-05   29.8   2.7   27  103-129    28-57  (65)
  2 PF05232 BTP:  Bacterial Transm  69.2     8.7 0.00019   26.9   3.8   24  102-125    34-57  (67)
  3 PF06738 DUF1212:  Protein of u  63.2     6.9 0.00015   30.2   2.5   24   33-63     73-96  (193)
  4 PF06464 DMAP_binding:  DMAP1-b  59.6       7 0.00015   29.5   2.0   17   51-67      6-22  (111)
  5 PF01405 PsbT:  Photosystem II   56.6      12 0.00026   23.7   2.3   17  102-118     7-23  (29)
  6 PRK01474 atpC F0F1 ATP synthas  55.7      13 0.00027   27.9   2.8   21   48-68     91-111 (112)
  7 PRK13743 conjugal transfer pro  50.6      17 0.00037   29.9   2.9   28  101-129    42-69  (141)
  8 PF11213 DUF3006:  Protein of u  48.9      21 0.00046   24.7   2.9   27   44-70     45-71  (71)
  9 PRK13454 F0F1 ATP synthase sub  46.4      26 0.00056   28.0   3.3   35   94-128    20-55  (181)
 10 TIGR00074 hypC_hupF hydrogenas  45.6      27 0.00058   25.3   3.0   23   48-70     52-74  (76)
 11 PRK11875 psbT photosystem II r  44.7      22 0.00048   22.8   2.2   17  102-118     7-23  (31)
 12 PLN03160 uncharacterized prote  44.3      23  0.0005   29.3   2.9   27  103-129    39-65  (219)
 13 PF04697 Pinin_SDK_N:  pinin/SD  43.8      20 0.00044   29.3   2.4   29   32-70      3-31  (134)
 14 PF09862 DUF2089:  Protein of u  42.7      17 0.00037   28.4   1.7   23   30-59     91-113 (113)
 15 PRK14736 atpC F0F1 ATP synthas  42.2      18  0.0004   28.1   1.9   25   48-72     88-112 (133)
 16 CHL00031 psbT photosystem II p  42.1      20 0.00044   23.3   1.7   18  101-118     6-23  (33)
 17 COG2966 Uncharacterized conser  39.9      24 0.00052   30.2   2.4   34   24-64     82-119 (250)
 18 PRK10413 hydrogenase 2 accesso  38.8      35 0.00076   25.1   2.8   20   48-67     59-78  (82)
 19 PRK09702 PTS system arbutin-sp  38.1      34 0.00073   27.7   2.9   26  101-127     7-32  (161)
 20 PRK13443 atpC F0F1 ATP synthas  37.3      38 0.00081   26.7   2.9   23   48-70     88-110 (136)
 21 KOG1758 Mitochondrial F1F0-ATP  36.0      25 0.00055   29.4   1.9   44   26-73     97-140 (159)
 22 PF00401 ATP-synt_DE:  ATP synt  34.2      44 0.00095   21.7   2.4   22   48-69      2-23  (48)
 23 PF09577 Spore_YpjB:  Sporulati  33.4 1.6E+02  0.0035   25.3   6.4   50   49-118   167-216 (232)
 24 TIGR01216 ATP_synt_epsi ATP sy  33.1      48   0.001   25.0   2.8   20   48-67     86-105 (130)
 25 TIGR03024 arch_pef_cterm PEF-C  31.7      62  0.0014   19.9   2.6   17   96-114     1-17  (26)
 26 CHL00063 atpE ATP synthase CF1  31.4      52  0.0011   25.2   2.8   21   48-68     86-106 (134)
 27 PRK13452 atpC F0F1 ATP synthas  30.7      54  0.0012   25.8   2.9   21   48-68     89-109 (145)
 28 PRK13444 atpC F0F1 ATP synthas  30.5      54  0.0012   24.9   2.8   20   48-67     89-108 (127)
 29 PF06781 UPF0233:  Uncharacteri  30.1 1.4E+02   0.003   22.4   4.8   28   98-125    27-54  (87)
 30 PRK13448 atpC F0F1 ATP synthas  29.7      59  0.0013   25.2   2.9   20   48-67     87-106 (135)
 31 PF00036 EF-hand_1:  EF hand;    29.7      43 0.00094   19.7   1.7   25   33-61      5-29  (29)
 32 PF09236 AHSP:  Alpha-haemoglob  28.7      52  0.0011   25.4   2.4   21   51-71     56-76  (89)
 33 PRK00571 atpC F0F1 ATP synthas  28.3      64  0.0014   24.5   2.8   20   48-67     88-107 (135)
 34 PRK13450 atpC F0F1 ATP synthas  28.3      60  0.0013   24.8   2.7   19   48-66     88-106 (132)
 35 PF03908 Sec20:  Sec20;  InterP  28.3      56  0.0012   23.3   2.4   25   95-119    63-87  (92)
 36 KOG0289 mRNA splicing factor [  27.1      46 0.00099   32.2   2.2   54   51-108   122-175 (506)
 37 PRK13446 atpC F0F1 ATP synthas  26.9      70  0.0015   24.6   2.8   20   48-67     88-107 (136)
 38 PRK05759 F0F1 ATP synthase sub  26.0      72  0.0016   23.9   2.7   21  108-128     8-28  (156)
 39 COG0109 CyoE Polyprenyltransfe  25.9      77  0.0017   28.6   3.3   25  105-129   121-146 (304)
 40 PF03791 KNOX2:  KNOX2 domain ;  25.8      74  0.0016   22.0   2.5   20   51-70     33-52  (52)
 41 PF06084 Cytomega_TRL10:  Cytom  25.6      34 0.00073   28.2   0.9   16  101-116    63-78  (150)
 42 TIGR03038 PS_II_psbM photosyst  25.5 1.2E+02  0.0026   19.7   3.2   26  102-128     4-29  (33)
 43 PRK09173 F0F1 ATP synthase sub  25.4      92   0.002   23.8   3.2   21   99-119     1-21  (159)
 44 PF09802 Sec66:  Preprotein tra  25.0      66  0.0014   27.1   2.6   18  102-119    11-28  (190)
 45 PF00430 ATP-synt_B:  ATP synth  25.0      72  0.0016   22.8   2.5   18  111-128     6-23  (132)
 46 PF13713 BRX_N:  Transcription   24.8      62  0.0013   21.3   1.9   21   52-72      8-28  (39)
 47 PRK00539 atpC F0F1 ATP synthas  24.1      84  0.0018   24.3   2.8   20   48-67     88-107 (133)
 48 PF08824 Serine_rich:  Serine r  24.0      77  0.0017   26.0   2.7   20   49-68      1-20  (159)
 49 TIGR02610 PHA_gran_rgn putativ  24.0      99  0.0022   22.9   3.1   22   47-68     10-31  (91)
 50 PF04834 Adeno_E3_14_5:  Early   23.5 1.3E+02  0.0028   23.4   3.7   36   94-129    15-50  (97)
 51 PRK02251 putative septation in  23.3 1.1E+02  0.0023   23.3   3.2   28   97-124    27-54  (87)
 52 PF11239 DUF3040:  Protein of u  23.2 2.7E+02  0.0059   19.5   5.8   16   52-67      5-20  (82)
 53 PF08946 Osmo_CC:  Osmosensory   23.0      32 0.00069   23.8   0.3   16   57-72     20-35  (46)
 54 PF03579 SHP:  Small hydrophobi  22.9      71  0.0015   23.4   2.1   24   95-118     6-29  (64)
 55 PRK04989 psbM photosystem II r  22.5 1.3E+02  0.0029   19.7   3.1   25  103-128     5-29  (35)
 56 PF12129 Phtf-FEM1B_bdg:  Male   21.9 2.8E+02  0.0061   23.2   5.6   51   63-114    29-81  (159)
 57 PRK14735 atpC F0F1 ATP synthas  21.6   1E+02  0.0022   23.9   2.9   20   48-67     86-105 (139)
 58 COG2012 RPB5 DNA-directed RNA   21.5      65  0.0014   24.4   1.7   45   48-92     20-70  (80)
 59 PRK10409 hydrogenase assembly   21.3 1.1E+02  0.0023   23.1   2.8   19   48-66     58-76  (90)
 60 PF01484 Col_cuticle_N:  Nemato  20.8 1.3E+02  0.0028   18.8   2.8   17  104-120     2-18  (53)
 61 CHL00019 atpF ATP synthase CF0  20.8   1E+02  0.0022   24.4   2.7   23  106-128    26-48  (184)
 62 PRK10204 hypothetical protein;  20.7      97  0.0021   22.1   2.3   23   44-66     32-54  (55)
 63 PF09650 PHA_gran_rgn:  Putativ  20.6 1.3E+02  0.0028   21.8   3.1   22   47-68      7-28  (87)
 64 PRK00159 putative septation in  20.6 1.2E+02  0.0027   23.0   3.0   28   97-124    26-53  (87)

No 1  
>PF08370 PDR_assoc:  Plant PDR ABC transporter associated;  InterPro: IPR013581 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This domain is found on the C terminus of ABC-2 type transporter domains (IPR013525 from INTERPRO). It seems to be associated with the plant pleiotropic drug resistance (PDR) protein family of ABC transporters. Like in yeast, plant PDR ABC transporters may also play a role in the transport of antifungal agents [] (see also IPR010929 from INTERPRO). The PDR family is characterised by a configuration in which the ABC domain is nearer the N terminus of the protein than the transmembrane domain []. 
Probab=76.21  E-value=2.8  Score=29.81  Aligned_cols=27  Identities=37%  Similarity=0.543  Sum_probs=20.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH---hhcccC
Q 030821          103 FLTNTTVALLIFTILYNVLFY---TVIKPS  129 (171)
Q Consensus       103 fla~sa~aLvifTIFyNVlF~---tvIKPS  129 (171)
                      +.=...+||+-|+|++|++|.   +|++|-
T Consensus        28 WyWIgvgaL~G~~vlFNil~~laL~yL~p~   57 (65)
T PF08370_consen   28 WYWIGVGALLGFIVLFNILFTLALTYLNPL   57 (65)
T ss_pred             EEeehHHHHHHHHHHHHHHHHHHHHhcCCc
Confidence            344567899999999999985   577763


No 2  
>PF05232 BTP:  Bacterial Transmembrane Pair family;  InterPro: IPR007896 This domain represents a conserved pair of transmembrane helices. It appears to be found as two tandem repeats in a family of hypothetical proteins.
Probab=69.22  E-value=8.7  Score=26.88  Aligned_cols=24  Identities=21%  Similarity=0.337  Sum_probs=18.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhh
Q 030821          102 SFLTNTTVALLIFTILYNVLFYTV  125 (171)
Q Consensus       102 Sfla~sa~aLvifTIFyNVlF~tv  125 (171)
                      .-..-+++++.++..+||.+||..
T Consensus        34 ~~a~~l~v~~s~~a~~wn~ifN~~   57 (67)
T PF05232_consen   34 WQAGALDVGLSLFAMVWNYIFNWL   57 (67)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            334456778888999999999975


No 3  
>PF06738 DUF1212:  Protein of unknown function (DUF1212);  InterPro: IPR010619 This entry represents a predicted domain found within a number of hypothetical proteins of unknown function found in eukaryotes, bacteria and archaea. Some of these sequences are predicted to be membrane proteins.
Probab=63.19  E-value=6.9  Score=30.24  Aligned_cols=24  Identities=25%  Similarity=0.468  Sum_probs=18.8

Q ss_pred             hhhhhhccCccCCcccCCHHHHHHHHHHHHH
Q 030821           33 VARAVENNNSQNSKFEIDPEEARQALQRLDQ   63 (171)
Q Consensus        33 ~v~a~ek~~~~~~q~eidpekAreaL~eLDq   63 (171)
                      ++|.+.++       ++++|||+++|++++.
T Consensus        73 l~~~~~~~-------~~~~~ea~~~L~~I~~   96 (193)
T PF06738_consen   73 LSRRIVAG-------QLSLEEAIERLDEIDR   96 (193)
T ss_pred             HHHHHhcC-------CCCHHHHHHHHHHHhh
Confidence            44555555       8999999999999875


No 4  
>PF06464 DMAP_binding:  DMAP1-binding Domain;  InterPro: IPR010506 This domain binds DMAP1, a transcriptional co-repressor.; GO: 0008134 transcription factor binding, 0005634 nucleus
Probab=59.60  E-value=7  Score=29.51  Aligned_cols=17  Identities=41%  Similarity=0.661  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHHHhh
Q 030821           51 PEEARQALQRLDQQLKS   67 (171)
Q Consensus        51 pekAreaL~eLDqQLes   67 (171)
                      |++.|.+|++||.++++
T Consensus         6 P~evq~~L~~L~~el~~   22 (111)
T PF06464_consen    6 PPEVQNRLQELDLELEE   22 (111)
T ss_pred             CHHHHHHHHHHHHhhhc
Confidence            88999999999999976


No 5  
>PF01405 PsbT:  Photosystem II reaction centre T protein;  InterPro: IPR001743 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbT found in PSII, which is thought to be associated with the D1 (PsbA) - D2 (PsbD) heterodimer. PsbT may be involved in the formation and/or stabilisation of dimeric PSII complexes, because in the absence of this protein dimeric PSII complexes were found to be less abundant. Furthermore, although PsbT does not confer photo-protection, it is required for the efficient recovery of photo-damaged PSII [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane; PDB: 3BZ1_T 1S5L_t 2AXT_t 3KZI_T 3PRQ_T 3BZ2_T 3PRR_T 4FBY_g 3A0H_t 3A0B_T ....
Probab=56.62  E-value=12  Score=23.69  Aligned_cols=17  Identities=35%  Similarity=0.757  Sum_probs=13.7

Q ss_pred             hHHHHHHHHHHHHHHHH
Q 030821          102 SFLTNTTVALLIFTILY  118 (171)
Q Consensus       102 Sfla~sa~aLvifTIFy  118 (171)
                      +|+-.+|+|+++|.||+
T Consensus         7 ~~ll~~tlgilffAI~F   23 (29)
T PF01405_consen    7 TFLLIGTLGILFFAIFF   23 (29)
T ss_dssp             HHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHhhhhc
Confidence            57778888888888875


No 6  
>PRK01474 atpC F0F1 ATP synthase subunit epsilon; Validated
Probab=55.74  E-value=13  Score=27.88  Aligned_cols=21  Identities=19%  Similarity=0.271  Sum_probs=18.8

Q ss_pred             cCCHHHHHHHHHHHHHHHhhc
Q 030821           48 EIDPEEARQALQRLDQQLKSL   68 (171)
Q Consensus        48 eidpekAreaL~eLDqQLesL   68 (171)
                      +||.++|++++++..++|...
T Consensus        91 ~ID~~~a~~~~~~A~~~l~~~  111 (112)
T PRK01474         91 NLSEAEIATKLLDLQKTLSDQ  111 (112)
T ss_pred             hCCHHHHHHHHHHHHHHHhhc
Confidence            799999999999999988753


No 7  
>PRK13743 conjugal transfer protein TrbF; Provisional
Probab=50.57  E-value=17  Score=29.92  Aligned_cols=28  Identities=18%  Similarity=0.402  Sum_probs=23.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhcccC
Q 030821          101 GSFLTNTTVALLIFTILYNVLFYTVIKPS  129 (171)
Q Consensus       101 ~Sfla~sa~aLvifTIFyNVlF~tvIKPS  129 (171)
                      +-|+.|+|+|+|+.+|. +++|.+.|.-=
T Consensus        42 ~LfiVFl~AG~vLw~vM-~~iFd~CIDsW   69 (141)
T PRK13743         42 DLFIVFLTAGIVLWVIM-HSIFDACIDSW   69 (141)
T ss_pred             HHHHHHHHhhHHHHHHH-HHHHHHHHHhh
Confidence            45889999999999985 78899988643


No 8  
>PF11213 DUF3006:  Protein of unknown function (DUF3006);  InterPro: IPR021377  This family of proteins has no known function. 
Probab=48.86  E-value=21  Score=24.72  Aligned_cols=27  Identities=30%  Similarity=0.490  Sum_probs=23.9

Q ss_pred             CCcccCCHHHHHHHHHHHHHHHhhccc
Q 030821           44 NSKFEIDPEEARQALQRLDQQLKSLSN   70 (171)
Q Consensus        44 ~~q~eidpekAreaL~eLDqQLesLs~   70 (171)
                      ...|++|+|+..++-++....++.|.+
T Consensus        45 ~~~~~~d~eeT~~r~~~i~~l~~~L~e   71 (71)
T PF11213_consen   45 DGSIEIDPEETEARRKEIQDLLDRLWE   71 (71)
T ss_pred             CceEEECHHHHHHHHHHHHHHHHHhhC
Confidence            368999999999999999999998864


No 9  
>PRK13454 F0F1 ATP synthase subunit B'; Provisional
Probab=46.39  E-value=26  Score=28.00  Aligned_cols=35  Identities=17%  Similarity=0.155  Sum_probs=24.1

Q ss_pred             CCccccchh-HHHHHHHHHHHHHHHHHHHHHhhccc
Q 030821           94 QETLEISGS-FLTNTTVALLIFTILYNVLFYTVIKP  128 (171)
Q Consensus        94 dE~pEiS~S-fla~sa~aLvifTIFyNVlF~tvIKP  128 (171)
                      .+.|.|..+ |..-+...+++|.|||=+|...+.+|
T Consensus        20 ~gmp~ld~~t~~~q~~~~lI~F~iL~~ll~k~l~~P   55 (181)
T PRK13454         20 PGMPQLDFSTFPNQIFWLLVTLVAIYFVLTRVALPR   55 (181)
T ss_pred             CCCCCCcHHhcchHHHHHHHHHHHHHHHHHHHHHHH
Confidence            357888885 55444455777888887777777776


No 10 
>TIGR00074 hypC_hupF hydrogenase assembly chaperone HypC/HupF. An additional proposed function is to shuttle the iron atom that has been liganded at the HypC/HypD complex to the precursor of the large hydrogenase (HycE) subunit. PubMed:12441107.
Probab=45.56  E-value=27  Score=25.34  Aligned_cols=23  Identities=30%  Similarity=0.544  Sum_probs=18.9

Q ss_pred             cCCHHHHHHHHHHHHHHHhhccc
Q 030821           48 EIDPEEARQALQRLDQQLKSLSN   70 (171)
Q Consensus        48 eidpekAreaL~eLDqQLesLs~   70 (171)
                      .||+++|+|.|+-|++-.+.+..
T Consensus        52 ~ide~eA~e~l~~l~el~~~~~~   74 (76)
T TIGR00074        52 VLDEEEARETLDALQELFDAVEE   74 (76)
T ss_pred             hCCHHHHHHHHHHHHHHHHHHhc
Confidence            68999999999999887776544


No 11 
>PRK11875 psbT photosystem II reaction center protein T; Reviewed
Probab=44.68  E-value=22  Score=22.82  Aligned_cols=17  Identities=18%  Similarity=0.444  Sum_probs=12.7

Q ss_pred             hHHHHHHHHHHHHHHHH
Q 030821          102 SFLTNTTVALLIFTILY  118 (171)
Q Consensus       102 Sfla~sa~aLvifTIFy  118 (171)
                      +||-.+++|+++|.||+
T Consensus         7 tfll~~tlgiiFFAIfF   23 (31)
T PRK11875          7 ILILTLALVTLFFAIAF   23 (31)
T ss_pred             HHHHHHHHHHHHHhhhc
Confidence            56777788888888775


No 12 
>PLN03160 uncharacterized protein; Provisional
Probab=44.30  E-value=23  Score=29.27  Aligned_cols=27  Identities=30%  Similarity=0.333  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcccC
Q 030821          103 FLTNTTVALLIFTILYNVLFYTVIKPS  129 (171)
Q Consensus       103 fla~sa~aLvifTIFyNVlF~tvIKPS  129 (171)
                      ...+.++.++++.+.-=++++||.||.
T Consensus        39 c~~~~~a~~l~l~~v~~~l~~~vfrPk   65 (219)
T PLN03160         39 CCGCITATLLILATTILVLVFTVFRVK   65 (219)
T ss_pred             EHHHHHHHHHHHHHHHHheeeEEEEcc
Confidence            455666666666777778888999994


No 13 
>PF04697 Pinin_SDK_N:  pinin/SDK conserved region;  InterPro: IPR006787 This conserved region is found at the N-terminal of the member proteins. It is located adjacent and N-terminal to the pinin/SKD/memA domain IPR006786 from INTERPRO. Members of this family have very varied localisations within the eukaryotic cell. Pinin is known to localise at the desmosomes and is implicated in anchoring intermediate filaments to the desmosomal plaque [, ]. SDK2/3 is a dynamically localised nuclear protein thought to be involved in modulation of alternative pre-mRNA splicing []. MemA is a tumour marker preferentially expressed in human melanoma cell lines. A common feature of the members of this family is that they may all participate in regulating protein-protein interactions [].
Probab=43.80  E-value=20  Score=29.26  Aligned_cols=29  Identities=28%  Similarity=0.574  Sum_probs=24.4

Q ss_pred             hhhhhhhccCccCCcccCCHHHHHHHHHHHHHHHhhccc
Q 030821           32 VVARAVENNNSQNSKFEIDPEEARQALQRLDQQLKSLSN   70 (171)
Q Consensus        32 ~~v~a~ek~~~~~~q~eidpekAreaL~eLDqQLesLs~   70 (171)
                      |+|+.+++.          .|+|+|.|+-+|.-|..|--
T Consensus         3 vav~~Lq~q----------lE~Ake~Lk~vDenIkKltG   31 (134)
T PF04697_consen    3 VAVRTLQAQ----------LEKAKESLKNVDENIKKLTG   31 (134)
T ss_pred             hhHHHHHHH----------HHHHHHHhhhhhHHHHHHhC
Confidence            567777766          89999999999999988765


No 14 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=42.65  E-value=17  Score=28.38  Aligned_cols=23  Identities=30%  Similarity=0.367  Sum_probs=18.2

Q ss_pred             cchhhhhhhccCccCCcccCCHHHHHHHHH
Q 030821           30 PSVVARAVENNNSQNSKFEIDPEEARQALQ   59 (171)
Q Consensus        30 ss~~v~a~ek~~~~~~q~eidpekAreaL~   59 (171)
                      -.-|..+++++       ||++|+|.+.|+
T Consensus        91 ~~~IL~~L~~G-------eIs~eeA~~~Lk  113 (113)
T PF09862_consen   91 RKEILDKLEKG-------EISVEEALEILK  113 (113)
T ss_pred             HHHHHHHHHcC-------CCCHHHHHHHhC
Confidence            34477788888       899999998875


No 15 
>PRK14736 atpC F0F1 ATP synthase subunit epsilon; Provisional
Probab=42.21  E-value=18  Score=28.05  Aligned_cols=25  Identities=12%  Similarity=0.327  Sum_probs=21.2

Q ss_pred             cCCHHHHHHHHHHHHHHHhhccccc
Q 030821           48 EIDPEEARQALQRLDQQLKSLSNKQ   72 (171)
Q Consensus        48 eidpekAreaL~eLDqQLesLs~~q   72 (171)
                      +||.++|++++++..+++.+=.+.+
T Consensus        88 eID~~~a~~a~~~Ae~~~~~~~~~~  112 (133)
T PRK14736         88 ELTPEMIDREIEAVEMERDATQDLD  112 (133)
T ss_pred             hCCHHHHHHHHHHHHHhhhcCCCHH
Confidence            8999999999999999988655543


No 16 
>CHL00031 psbT photosystem II protein T
Probab=42.07  E-value=20  Score=23.28  Aligned_cols=18  Identities=28%  Similarity=0.678  Sum_probs=13.4

Q ss_pred             hhHHHHHHHHHHHHHHHH
Q 030821          101 GSFLTNTTVALLIFTILY  118 (171)
Q Consensus       101 ~Sfla~sa~aLvifTIFy  118 (171)
                      =+||-.+|+|+++|.||+
T Consensus         6 Ytfll~~tlgilFFAI~F   23 (33)
T CHL00031          6 YTFLLVSTLGIIFFAIFF   23 (33)
T ss_pred             HHHHHHHHHHHHHHhhee
Confidence            356777788888888875


No 17 
>COG2966 Uncharacterized conserved protein [Function unknown]
Probab=39.85  E-value=24  Score=30.20  Aligned_cols=34  Identities=32%  Similarity=0.405  Sum_probs=24.2

Q ss_pred             ccCCCCcch----hhhhhhccCccCCcccCCHHHHHHHHHHHHHH
Q 030821           24 YVNNPSPSV----VARAVENNNSQNSKFEIDPEEARQALQRLDQQ   64 (171)
Q Consensus        24 ~v~~~Sss~----~v~a~ek~~~~~~q~eidpekAreaL~eLDqQ   64 (171)
                      ...|....+    ++++++++       +.|.|+|.+.|.+++++
T Consensus        82 ~~~nl~kvs~v~~i~~~v~~~-------~~~~e~a~~~l~~i~~~  119 (250)
T COG2966          82 RGINLEKVSEVNRISRAVEHG-------RLDLEEAHKKLDEIQKQ  119 (250)
T ss_pred             CCccHHHHHHHHHHHHHHHcC-------CCCHHHHHHHHHHhhhC
Confidence            555555444    45666666       89999999999988753


No 18 
>PRK10413 hydrogenase 2 accessory protein HypG; Provisional
Probab=38.82  E-value=35  Score=25.11  Aligned_cols=20  Identities=35%  Similarity=0.378  Sum_probs=17.0

Q ss_pred             cCCHHHHHHHHHHHHHHHhh
Q 030821           48 EIDPEEARQALQRLDQQLKS   67 (171)
Q Consensus        48 eidpekAreaL~eLDqQLes   67 (171)
                      .||.|+|+|.|+-|++-+.+
T Consensus        59 ~ideeeA~etl~~l~el~~~   78 (82)
T PRK10413         59 IIDEDEAKATLDALRQMEYD   78 (82)
T ss_pred             hCCHHHHHHHHHHHHHHHhh
Confidence            68999999999999877655


No 19 
>PRK09702 PTS system arbutin-specific transporter subunit IIB; Provisional
Probab=38.09  E-value=34  Score=27.74  Aligned_cols=26  Identities=27%  Similarity=0.406  Sum_probs=19.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhcc
Q 030821          101 GSFLTNTTVALLIFTILYNVLFYTVIK  127 (171)
Q Consensus       101 ~Sfla~sa~aLvifTIFyNVlF~tvIK  127 (171)
                      +.||+-..+|++.|-|.|=| |+.+||
T Consensus         7 ~~~~~~i~iGl~~f~iYyfv-F~flI~   32 (161)
T PRK09702          7 DMMLTQIAIGLCFTLLYFVV-FRTLIL   32 (161)
T ss_pred             ccchhHHHHHHHHHHHHHHH-HHHHHH
Confidence            57899999999888877755 555553


No 20 
>PRK13443 atpC F0F1 ATP synthase subunit epsilon; Provisional
Probab=37.25  E-value=38  Score=26.67  Aligned_cols=23  Identities=4%  Similarity=-0.054  Sum_probs=20.5

Q ss_pred             cCCHHHHHHHHHHHHHHHhhccc
Q 030821           48 EIDPEEARQALQRLDQQLKSLSN   70 (171)
Q Consensus        48 eidpekAreaL~eLDqQLesLs~   70 (171)
                      +||.++|++++++..++|+....
T Consensus        88 dID~~~a~~a~~~Ae~~l~~~~~  110 (136)
T PRK13443         88 ELTGAVLDEFIAEARELASVALP  110 (136)
T ss_pred             hCCHHHHHHHHHHHHHHHHhcCc
Confidence            89999999999999999987643


No 21 
>KOG1758 consensus Mitochondrial F1F0-ATP synthase, subunit delta/ATP16 [Energy production and conversion]
Probab=36.04  E-value=25  Score=29.42  Aligned_cols=44  Identities=32%  Similarity=0.377  Sum_probs=32.4

Q ss_pred             CCCCcchhhhhhhccCccCCcccCCHHHHHHHHHHHHHHHhhcccccC
Q 030821           26 NNPSPSVVARAVENNNSQNSKFEIDPEEARQALQRLDQQLKSLSNKQI   73 (171)
Q Consensus        26 ~~~Sss~~v~a~ek~~~~~~q~eidpekAreaL~eLDqQLesLs~~q~   73 (171)
                      .|..|+|-+-|.|-..-+    .||+.+|+.-|++-.+++-+-+.++.
T Consensus        97 v~~ds~~~ila~EA~~le----did~~~a~q~Le~aqa~l~~a~de~~  140 (159)
T KOG1758|consen   97 VNADSSLQILAEEAVKLE----DIDPSEAQQLLEKAQAKLVSASDERE  140 (159)
T ss_pred             EcCCCeEEEEehhccccc----cCCHHHHHHHHHHHHHHhcccccHHH
Confidence            455666666666655333    89999999999999999887766543


No 22 
>PF00401 ATP-synt_DE:  ATP synthase, Delta/Epsilon chain, long alpha-helix domain;  InterPro: IPR020547 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This family represents subunits called delta (in mitochondrial ATPase) or epsilon (in bacteria or chloroplast ATPase). The interaction site of subunit C of the F0 complex with the delta or epsilon subunit of the F1 complex may be important for connecting the rotor of F1 (gamma subunit) to the rotor of F0 (C subunit) []. In bacterial species, the delta subunit is the equivalent of the Oligomycin sensitive subunit (OSCP, IPR000711 from INTERPRO) in metazoans. The C-terminal domain of the epsilon subunit appears to act as an inhibitor of ATPase activity []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0046933 hydrogen ion transporting ATP synthase activity, rotational mechanism, 0046961 proton-transporting ATPase activity, rotational mechanism, 0015986 ATP synthesis coupled proton transport, 0045261 proton-transporting ATP synthase complex, catalytic core F(1); PDB: 3OAA_P 1BSN_A 1FS0_E 1AQT_A 1BSH_A 2RQ7_A 2RQ6_A 2E5Y_A 2QE7_H 2E5T_A ....
Probab=34.22  E-value=44  Score=21.72  Aligned_cols=22  Identities=32%  Similarity=0.531  Sum_probs=18.3

Q ss_pred             cCCHHHHHHHHHHHHHHHhhcc
Q 030821           48 EIDPEEARQALQRLDQQLKSLS   69 (171)
Q Consensus        48 eidpekAreaL~eLDqQLesLs   69 (171)
                      +||.++|++++++-.++|+.-.
T Consensus         2 dID~~rA~~a~~~Ae~~l~~~~   23 (48)
T PF00401_consen    2 DIDEERAEEAKERAEERLEKAK   23 (48)
T ss_dssp             CCHHHHHHHHHHHHHHHHTTCS
T ss_pred             cCCHHHHHHHHHHHHHHHHhCc
Confidence            6899999999999888887653


No 23 
>PF09577 Spore_YpjB:  Sporulation protein YpjB (SpoYpjB);  InterPro: IPR014231 Proteins in thie entry, typified by YpjB, are restricted to a subset of the endospore-forming bacteria which includes Bacillus species, but not species. In Bacillus subtilis, ypjB was found to be part of the sigma-E regulon []. Sigma-E is a sporulation sigma factor that regulates expression in the mother cell compartment. Null mutants of ypjB show a sporulation defect, but this gene is not, however, a part of the endospore formation minimal gene set.
Probab=33.44  E-value=1.6e+02  Score=25.34  Aligned_cols=50  Identities=22%  Similarity=0.359  Sum_probs=35.6

Q ss_pred             CCHHHHHHHHHHHHHHHhhcccccCCCCCCccccccccCCCCCCCCCccccchhHHHHHHHHHHHHHHHH
Q 030821           49 IDPEEARQALQRLDQQLKSLSNKQISSPKIKAADVKITRGPGPAEQETLEISGSFLTNTTVALLIFTILY  118 (171)
Q Consensus        49 idpekAreaL~eLDqQLesLs~~q~rpP~~~~sDv~~tr~~~~~~dE~pEiS~Sfla~sa~aLvifTIFy  118 (171)
                      .+.++-+++|..|.+.|+.|=.....-                  +..|  |-.++..+++|++++|..|
T Consensus       167 ~~~~~~~~~l~~le~~l~~lF~~~k~d------------------~~dp--sl~Wv~l~iG~iIi~tLtY  216 (232)
T PF09577_consen  167 LDQKEVQEALEQLEEDLQKLFDGVKED------------------EADP--SLIWVMLSIGGIIIATLTY  216 (232)
T ss_pred             cChHHHHHHHHHHHHHHHHHhCccccc------------------cccc--chHHHHHHHHHHHHHHHHH
Confidence            456788899999999999887654311                  0111  3356678889999999888


No 24 
>TIGR01216 ATP_synt_epsi ATP synthase, F1 epsilon subunit (delta in mitochondria). This model describes one of the five types of subunits in the F1 part of F1/F0 ATP synthases. Members of this family are designated epsilon in bacterial and chloroplast systems but designated delta in mitochondria, where the counterpart of the bacterial delta subunit is designated OSCP. In a few cases (Propionigenium modestum, Acetobacterium woodii) scoring above the trusted cutoff and designated here as exceptions, Na+ replaces H+ for translocation.
Probab=33.14  E-value=48  Score=25.05  Aligned_cols=20  Identities=40%  Similarity=0.586  Sum_probs=18.6

Q ss_pred             cCCHHHHHHHHHHHHHHHhh
Q 030821           48 EIDPEEARQALQRLDQQLKS   67 (171)
Q Consensus        48 eidpekAreaL~eLDqQLes   67 (171)
                      +||.++|+++++++.++|+.
T Consensus        86 ~id~~~a~~~~~~ae~~l~~  105 (130)
T TIGR01216        86 DIDEAEAEKALEAAEKLLES  105 (130)
T ss_pred             cCCHHHHHHHHHHHHHHHhh
Confidence            89999999999999999976


No 25 
>TIGR03024 arch_pef_cterm PEF-C-terminal archaeal protein sorting domain. This domain, distantly related to the PEP-Cterm domain described in model TIGR02595, is found in Methanosarcina mazei in four different proteins, as well as in other archaea such as Methanococcoides burtonii. Several proteins with this domain have their genes only a short distance from a distant homology of EpsH, a proposed integral membrane transpeptidase.
Probab=31.67  E-value=62  Score=19.86  Aligned_cols=17  Identities=29%  Similarity=0.313  Sum_probs=10.1

Q ss_pred             ccccchhHHHHHHHHHHHH
Q 030821           96 TLEISGSFLTNTTVALLIF  114 (171)
Q Consensus        96 ~pEiS~Sfla~sa~aLvif  114 (171)
                      .||||  +++..-++++.+
T Consensus         1 IPEF~--~i~l~I~all~i   17 (26)
T TIGR03024         1 VPEFS--TIALPIIALLAI   17 (26)
T ss_pred             CCCCc--chHHHHHHHHHH
Confidence            48998  555555555444


No 26 
>CHL00063 atpE ATP synthase CF1 epsilon subunit
Probab=31.38  E-value=52  Score=25.24  Aligned_cols=21  Identities=38%  Similarity=0.650  Sum_probs=19.0

Q ss_pred             cCCHHHHHHHHHHHHHHHhhc
Q 030821           48 EIDPEEARQALQRLDQQLKSL   68 (171)
Q Consensus        48 eidpekAreaL~eLDqQLesL   68 (171)
                      +||.++|++++++..++|++-
T Consensus        86 dID~~~a~~~~~~A~~~l~~~  106 (134)
T CHL00063         86 DIDPQEAQQTLEIAEANLEKA  106 (134)
T ss_pred             hCCHHHHHHHHHHHHHHHHhC
Confidence            899999999999999999763


No 27 
>PRK13452 atpC F0F1 ATP synthase subunit epsilon; Provisional
Probab=30.72  E-value=54  Score=25.79  Aligned_cols=21  Identities=29%  Similarity=0.376  Sum_probs=19.1

Q ss_pred             cCCHHHHHHHHHHHHHHHhhc
Q 030821           48 EIDPEEARQALQRLDQQLKSL   68 (171)
Q Consensus        48 eidpekAreaL~eLDqQLesL   68 (171)
                      +||.++|++++++..++|+..
T Consensus        89 eID~~~ae~a~~~Ae~~L~~~  109 (145)
T PRK13452         89 NLNQAEAEKARARAKEVLKNP  109 (145)
T ss_pred             cCCHHHHHHHHHHHHHHHHhc
Confidence            899999999999999998764


No 28 
>PRK13444 atpC F0F1 ATP synthase subunit epsilon; Provisional
Probab=30.46  E-value=54  Score=24.94  Aligned_cols=20  Identities=25%  Similarity=0.371  Sum_probs=18.8

Q ss_pred             cCCHHHHHHHHHHHHHHHhh
Q 030821           48 EIDPEEARQALQRLDQQLKS   67 (171)
Q Consensus        48 eidpekAreaL~eLDqQLes   67 (171)
                      +||.++|++++++..++|+.
T Consensus        89 diD~~~a~~~~~~Ae~~l~~  108 (127)
T PRK13444         89 DIDHEHEKKLLAEAEKLPPS  108 (127)
T ss_pred             hCCHHHHHHHHHHHHHHHhC
Confidence            79999999999999999976


No 29 
>PF06781 UPF0233:  Uncharacterised protein family (UPF0233);  InterPro: IPR009619 This is a group of proteins of unknown function.
Probab=30.08  E-value=1.4e+02  Score=22.43  Aligned_cols=28  Identities=18%  Similarity=0.451  Sum_probs=24.2

Q ss_pred             ccchhHHHHHHHHHHHHHHHHHHHHHhh
Q 030821           98 EISGSFLTNTTVALLIFTILYNVLFYTV  125 (171)
Q Consensus        98 EiS~Sfla~sa~aLvifTIFyNVlF~tv  125 (171)
                      .-||..++-..+||+++.++.=|+||.-
T Consensus        27 ~~sp~W~~p~m~~lmllGL~WiVvyYi~   54 (87)
T PF06781_consen   27 KPSPRWYAPLMLGLMLLGLLWIVVYYIS   54 (87)
T ss_pred             CCCCccHHHHHHHHHHHHHHHHhhhhcc
Confidence            5688899999999999999999999863


No 30 
>PRK13448 atpC F0F1 ATP synthase subunit epsilon; Provisional
Probab=29.69  E-value=59  Score=25.19  Aligned_cols=20  Identities=15%  Similarity=0.370  Sum_probs=18.4

Q ss_pred             cCCHHHHHHHHHHHHHHHhh
Q 030821           48 EIDPEEARQALQRLDQQLKS   67 (171)
Q Consensus        48 eidpekAreaL~eLDqQLes   67 (171)
                      +||.++|++++++..+.|++
T Consensus        87 dID~~~a~~~~~~Ae~~l~~  106 (135)
T PRK13448         87 DLDLAQFAATIAEMEAQLAG  106 (135)
T ss_pred             cCCHHHHHHHHHHHHHHHhh
Confidence            79999999999999998876


No 31 
>PF00036 EF-hand_1:  EF hand;  InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand. This type of domain consists of a twelve residue loop flanked on both sides by a twelve residue alpha-helical domain. In an EF-hand loop the calcium ion is coordinated in a pentagonal bipyramidal configuration. The six residues involved in the binding are in positions 1, 3, 5, 7, 9 and 12; these residues are denoted by X, Y, Z, -Y, -X and -Z. The invariant Glu or Asp at position 12 provides two oxygens for liganding Ca (bidentate ligand).; PDB: 1BJF_A 1XFW_R 1XFV_O 2K0J_A 2F3Z_A 3BYA_A 1XFU_Q 2R28_B 1ZOT_B 3G43_D ....
Probab=29.66  E-value=43  Score=19.72  Aligned_cols=25  Identities=24%  Similarity=0.453  Sum_probs=20.3

Q ss_pred             hhhhhhccCccCCcccCCHHHHHHHHHHH
Q 030821           33 VARAVENNNSQNSKFEIDPEEARQALQRL   61 (171)
Q Consensus        33 ~v~a~ek~~~~~~q~eidpekAreaL~eL   61 (171)
                      +.+..+++|++    .|+.+|=++.+++|
T Consensus         5 ~F~~~D~d~dG----~I~~~Ef~~~~~~L   29 (29)
T PF00036_consen    5 AFREFDKDGDG----KIDFEEFKEMMKKL   29 (29)
T ss_dssp             HHHHHSTTSSS----EEEHHHHHHHHHHT
T ss_pred             HHHHHCCCCCC----cCCHHHHHHHHHhC
Confidence            34667888888    89999999988875


No 32 
>PF09236 AHSP:  Alpha-haemoglobin stabilising protein;  InterPro: IPR015317 Alpha-haemoglobin stabilising protein (AHSP) acts a molecular chaperone for free alpha-haemoglobin, preventing the harmful aggregation of alpha-haemoglobin during normal erythroid cell development: it specifically protects free alpha-haemoglobin from precipitation. AHSP adopts a helical secondary structure consisting of an elongated antiparallel three alpha-helix bundle []. ; GO: 0030492 hemoglobin binding, 0006457 protein folding, 0020027 hemoglobin metabolic process, 0030097 hemopoiesis, 0050821 protein stabilization; PDB: 1Y01_A 1XZY_A 3OVU_A 1W0A_A 3IA3_C 1Z8U_A 1W0B_A 1W09_A.
Probab=28.74  E-value=52  Score=25.39  Aligned_cols=21  Identities=43%  Similarity=0.627  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHHhhcccc
Q 030821           51 PEEARQALQRLDQQLKSLSNK   71 (171)
Q Consensus        51 pekAreaL~eLDqQLesLs~~   71 (171)
                      ..|-.+||+||.|.|+.|++|
T Consensus        56 qqeqdrAlqel~qeL~tla~p   76 (89)
T PF09236_consen   56 QQEQDRALQELQQELNTLANP   76 (89)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHH
Confidence            456678899999999999875


No 33 
>PRK00571 atpC F0F1 ATP synthase subunit epsilon; Validated
Probab=28.35  E-value=64  Score=24.46  Aligned_cols=20  Identities=30%  Similarity=0.528  Sum_probs=18.6

Q ss_pred             cCCHHHHHHHHHHHHHHHhh
Q 030821           48 EIDPEEARQALQRLDQQLKS   67 (171)
Q Consensus        48 eidpekAreaL~eLDqQLes   67 (171)
                      +||.++|++++++..++|+.
T Consensus        88 ~id~~~a~~~~~~ae~~l~~  107 (135)
T PRK00571         88 DIDEARAEEAKERAEEALEN  107 (135)
T ss_pred             hCCHHHHHHHHHHHHHHHhh
Confidence            79999999999999999876


No 34 
>PRK13450 atpC F0F1 ATP synthase subunit epsilon; Provisional
Probab=28.29  E-value=60  Score=24.85  Aligned_cols=19  Identities=37%  Similarity=0.574  Sum_probs=17.6

Q ss_pred             cCCHHHHHHHHHHHHHHHh
Q 030821           48 EIDPEEARQALQRLDQQLK   66 (171)
Q Consensus        48 eidpekAreaL~eLDqQLe   66 (171)
                      +||.++|++++++..++|+
T Consensus        88 ~ID~~~a~~~~~~A~~~l~  106 (132)
T PRK13450         88 EIDIKRAENAKKRAEERLR  106 (132)
T ss_pred             cCCHHHHHHHHHHHHHHHh
Confidence            8999999999999999984


No 35 
>PF03908 Sec20:  Sec20;  InterPro: IPR005606 Sec20 is a membrane glycoprotein associated with secretory pathway.
Probab=28.28  E-value=56  Score=23.29  Aligned_cols=25  Identities=16%  Similarity=0.304  Sum_probs=20.5

Q ss_pred             CccccchhHHHHHHHHHHHHHHHHH
Q 030821           95 ETLEISGSFLTNTTVALLIFTILYN  119 (171)
Q Consensus        95 E~pEiS~Sfla~sa~aLvifTIFyN  119 (171)
                      +.-+..+-++-++++++|+++++|=
T Consensus        63 ~r~~~~D~~li~~~~~~f~~~v~yI   87 (92)
T PF03908_consen   63 ERRDKTDRILIFFAFLFFLLVVLYI   87 (92)
T ss_pred             HHHHHHhHHHHHHHHHHHHHHHHHH
Confidence            3456788899999999999998884


No 36 
>KOG0289 consensus mRNA splicing factor [General function prediction only]
Probab=27.15  E-value=46  Score=32.16  Aligned_cols=54  Identities=19%  Similarity=0.302  Sum_probs=35.9

Q ss_pred             HHHHHHHHHHHHHHHhhcccccCCCCCCccccccccCCCCCCCCCccccchhHHHHHH
Q 030821           51 PEEARQALQRLDQQLKSLSNKQISSPKIKAADVKITRGPGPAEQETLEISGSFLTNTT  108 (171)
Q Consensus        51 pekAreaL~eLDqQLesLs~~q~rpP~~~~sDv~~tr~~~~~~dE~pEiS~Sfla~sa  108 (171)
                      .++|||+|++|.+|+--.. |+--|-....+++...+|..   +..|-+|+....-..
T Consensus       122 ~~eareaLa~~~~qa~a~~-peav~~~~~~s~~~va~ge~---~d~~g~s~~i~~~l~  175 (506)
T KOG0289|consen  122 RDEAREALAKLSPQAGAIV-PEAVPSLAQSSVVGVAAGES---EDQPGLSPEIIQKLE  175 (506)
T ss_pred             HHHHHHHHhhcCccccccc-ccccccccccchhhhhcCCc---cccccCCHHHHHHHH
Confidence            6899999999999975444 43333333346677666665   356778887665443


No 37 
>PRK13446 atpC F0F1 ATP synthase subunit epsilon; Provisional
Probab=26.94  E-value=70  Score=24.56  Aligned_cols=20  Identities=60%  Similarity=0.787  Sum_probs=18.6

Q ss_pred             cCCHHHHHHHHHHHHHHHhh
Q 030821           48 EIDPEEARQALQRLDQQLKS   67 (171)
Q Consensus        48 eidpekAreaL~eLDqQLes   67 (171)
                      +||.++|++++++..++|+.
T Consensus        88 ~iD~~~a~~~~~~A~~~l~~  107 (136)
T PRK13446         88 EIDVERARAALERAEQRLKK  107 (136)
T ss_pred             hCCHHHHHHHHHHHHHHHHh
Confidence            79999999999999999976


No 38 
>PRK05759 F0F1 ATP synthase subunit B; Validated
Probab=25.99  E-value=72  Score=23.95  Aligned_cols=21  Identities=29%  Similarity=0.314  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHHHhhccc
Q 030821          108 TVALLIFTILYNVLFYTVIKP  128 (171)
Q Consensus       108 a~aLvifTIFyNVlF~tvIKP  128 (171)
                      -+.++.|-|||=+|.+.+.||
T Consensus         8 ~~~~i~Flil~~il~~~~~~p   28 (156)
T PRK05759          8 IGQLIAFLILVWFIMKFVWPP   28 (156)
T ss_pred             HHHHHHHHHHHHHHHHHhHHH
Confidence            344555556666666666665


No 39 
>COG0109 CyoE Polyprenyltransferase (cytochrome oxidase assembly factor) [Posttranslational modification, protein turnover, chaperones]
Probab=25.91  E-value=77  Score=28.58  Aligned_cols=25  Identities=28%  Similarity=0.498  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHhh-cccC
Q 030821          105 TNTTVALLIFTILYNVLFYTV-IKPS  129 (171)
Q Consensus       105 a~sa~aLvifTIFyNVlF~tv-IKPS  129 (171)
                      ...++.|.+++||++|.-||. .|+.
T Consensus       121 n~laa~l~~~gi~~Yv~vYT~~lKR~  146 (304)
T COG0109         121 NLLAAVLGLFGIFFYVVVYTLWLKRR  146 (304)
T ss_pred             HHHHHHHHHHHHHHHhhhhhhhccCC
Confidence            445667888999999998887 7764


No 40 
>PF03791 KNOX2:  KNOX2 domain ;  InterPro: IPR005541 The MEINOX region is comprised of two domains, KNOX1 and KNOX2. KNOX1 plays a role in suppressing target gene expression. KNOX2, essential for function, is thought to be necessary for homo-dimerization [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=25.79  E-value=74  Score=22.02  Aligned_cols=20  Identities=35%  Similarity=0.419  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHHHHhhccc
Q 030821           51 PEEARQALQRLDQQLKSLSN   70 (171)
Q Consensus        51 pekAreaL~eLDqQLesLs~   70 (171)
                      -.||-..+.++.+||.+|.+
T Consensus        33 ~~EA~~f~~~ie~qL~~Lt~   52 (52)
T PF03791_consen   33 FQEAMEFCREIEQQLSSLTG   52 (52)
T ss_pred             HHHHHHHHHHHHHHHHHHhC
Confidence            35899999999999999863


No 41 
>PF06084 Cytomega_TRL10:  Cytomegalovirus TRL10 protein;  InterPro: IPR009284 This family consists of several Cytomegalovirus TRL10 proteins. TRL10 represents a structural component of the virus particle and like the other HCMV envelope glycoproteins, is present in a disulphide-linked complex [].
Probab=25.56  E-value=34  Score=28.20  Aligned_cols=16  Identities=38%  Similarity=0.779  Sum_probs=8.7

Q ss_pred             hhHHHHHHHHHHHHHH
Q 030821          101 GSFLTNTTVALLIFTI  116 (171)
Q Consensus       101 ~Sfla~sa~aLvifTI  116 (171)
                      |||+|.+.+-||+|-+
T Consensus        63 gsfiatliillviffv   78 (150)
T PF06084_consen   63 GSFIATLIILLVIFFV   78 (150)
T ss_pred             chHHHHHHHHHHHhhe
Confidence            5666665555555433


No 42 
>TIGR03038 PS_II_psbM photosystem II reaction center protein PsbM. Members of this protein family are the photosystem II reaction center M protein, product of the psbM gene, in Cyanobacteria and their derived organelles in plants. This model resembles Pfam model pfam05151 but has cutoffs set to avoid false-positive matches to similar (not necessarily homologous) sequences in species that are not photosynthetic.
Probab=25.46  E-value=1.2e+02  Score=19.71  Aligned_cols=26  Identities=19%  Similarity=0.230  Sum_probs=16.4

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHhhccc
Q 030821          102 SFLTNTTVALLIFTILYNVLFYTVIKP  128 (171)
Q Consensus       102 Sfla~sa~aLvifTIFyNVlF~tvIKP  128 (171)
                      ..++|.|.+|+++ |=+-.|.++|||-
T Consensus         4 n~l~fiAt~Lfi~-iPt~FLiilYvqT   29 (33)
T TIGR03038         4 NILGFIATLLFIL-VPTVFLLILYIQT   29 (33)
T ss_pred             cHHHHHHHHHHHH-HHHHHHHHHheec
Confidence            3578888877765 2333466777774


No 43 
>PRK09173 F0F1 ATP synthase subunit B; Validated
Probab=25.38  E-value=92  Score=23.82  Aligned_cols=21  Identities=14%  Similarity=0.390  Sum_probs=12.4

Q ss_pred             cchhHHHHHHHHHHHHHHHHH
Q 030821           99 ISGSFLTNTTVALLIFTILYN  119 (171)
Q Consensus        99 iS~Sfla~sa~aLvifTIFyN  119 (171)
                      |.+.|..+.++++|+|-++|=
T Consensus         1 ~~~~~w~~i~f~i~l~~l~~~   21 (159)
T PRK09173          1 MDATFWAFVGLVLFLALVVYL   21 (159)
T ss_pred             CCchHHHHHHHHHHHHHHHHH
Confidence            355666666666665555443


No 44 
>PF09802 Sec66:  Preprotein translocase subunit Sec66;  InterPro: IPR018624  Members of this family of proteins are a component of the heterotetrameric Sec62/63 complex composed of SEC62, SEC63, SEC66 and SEC72. The Sec62/63 complex associates with the Sec61 complex to form the Sec complex. Sec 66 is involved in SRP-independent post-translational translocation across the endoplasmic reticulum and functions together with the Sec61 complex and KAR2 in a channel-forming translocon complex. Furthermore, Sec66 is also required for growth at elevated temperatures [, , , ]. 
Probab=25.04  E-value=66  Score=27.13  Aligned_cols=18  Identities=17%  Similarity=0.421  Sum_probs=16.0

Q ss_pred             hHHHHHHHHHHHHHHHHH
Q 030821          102 SFLTNTTVALLIFTILYN  119 (171)
Q Consensus       102 Sfla~sa~aLvifTIFyN  119 (171)
                      .|++.+.++|.+|+++|=
T Consensus        11 ~Y~~vl~~sl~~Fs~~YR   28 (190)
T PF09802_consen   11 AYVAVLVGSLATFSSIYR   28 (190)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            589999999999999993


No 45 
>PF00430 ATP-synt_B:  ATP synthase B/B' CF(0);  InterPro: IPR002146 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunits B and B' from the F0 complex in F-ATPases found in chloroplasts and in bacterial plasma membranes. The B subunits are part of the peripheral stalk that links the F1 and F0 complexes together, and which acts as a stator to prevent certain subunits from rotating with the central rotary element. The peripheral stalk differs in subunit composition between mitochondrial, chloroplast and bacterial F-ATPases. In bacterial and chloroplast F-ATPases, the peripheral stalk is composed of one copy of the delta subunit (homologous to OSCP in mitochondria), and two copies of subunit B in bacteria, or one copy each of subunits B and B' in chloroplasts and photosynthetic bacteria []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o); PDB: 1L2P_A 2KHK_A 1B9U_A.
Probab=24.98  E-value=72  Score=22.80  Aligned_cols=18  Identities=39%  Similarity=0.556  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHHhhccc
Q 030821          111 LLIFTILYNVLFYTVIKP  128 (171)
Q Consensus       111 LvifTIFyNVlF~tvIKP  128 (171)
                      ++.|.|||=+|++.+.||
T Consensus         6 ~i~Flil~~~l~~~~~~p   23 (132)
T PF00430_consen    6 LINFLILFFLLNKFLYKP   23 (132)
T ss_dssp             HHHHHHHHHHHHHHTHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            445555555555555555


No 46 
>PF13713 BRX_N:  Transcription factor BRX N-terminal domain
Probab=24.82  E-value=62  Score=21.28  Aligned_cols=21  Identities=29%  Similarity=0.521  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHhhccccc
Q 030821           52 EEARQALQRLDQQLKSLSNKQ   72 (171)
Q Consensus        52 ekAreaL~eLDqQLesLs~~q   72 (171)
                      --|+|..+-|..||..++++-
T Consensus         8 kaaKe~IKsLt~QlK~maekl   28 (39)
T PF13713_consen    8 KAAKEVIKSLTAQLKDMAEKL   28 (39)
T ss_pred             HHHHHHHHHHHHHHHHHHHhC
Confidence            358899999999999999865


No 47 
>PRK00539 atpC F0F1 ATP synthase subunit epsilon; Validated
Probab=24.07  E-value=84  Score=24.34  Aligned_cols=20  Identities=25%  Similarity=0.483  Sum_probs=18.7

Q ss_pred             cCCHHHHHHHHHHHHHHHhh
Q 030821           48 EIDPEEARQALQRLDQQLKS   67 (171)
Q Consensus        48 eidpekAreaL~eLDqQLes   67 (171)
                      +||.++|.+++++..++|+.
T Consensus        88 eID~~~a~~a~erAe~~L~~  107 (133)
T PRK00539         88 ELDYDETLKRKKELERKIKH  107 (133)
T ss_pred             hCCHHHHHHHHHHHHHHHHh
Confidence            89999999999999999976


No 48 
>PF08824 Serine_rich:  Serine rich protein interaction domain;  InterPro: IPR014928 This is a serine rich protein that is found in the docking protein p130(cas) (Crk-associated substrate). The protein folds into a four helix bundle which is associated with protein-protein interactions []. ; PDB: 2L81_A 1Z23_A.
Probab=24.03  E-value=77  Score=25.96  Aligned_cols=20  Identities=35%  Similarity=0.537  Sum_probs=16.2

Q ss_pred             CCHHHHHHHHHHHHHHHhhc
Q 030821           49 IDPEEARQALQRLDQQLKSL   68 (171)
Q Consensus        49 idpekAreaL~eLDqQLesL   68 (171)
                      .|+|.|.|.|.+|+|.+++=
T Consensus         1 Ld~d~A~e~L~~LQ~~v~~s   20 (159)
T PF08824_consen    1 LDLDAAMETLSRLQQEVESS   20 (159)
T ss_dssp             --HHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHH
Confidence            37899999999999998763


No 49 
>TIGR02610 PHA_gran_rgn putative polyhydroxyalkanoic acid system protein. All members of this family are encoded by genes polyhydroxyalkanoic acid (PHA) biosynthesis and utilization genes, including proteins at found at the surface of PHA granules. Examples so far are found in the Pseudomonales, Xanthomonadales, and Vibrionales, all of which belong to the Gammaproteobacteria.
Probab=24.01  E-value=99  Score=22.88  Aligned_cols=22  Identities=23%  Similarity=0.401  Sum_probs=17.4

Q ss_pred             ccCCHHHHHHHHHHHHHHHhhc
Q 030821           47 FEIDPEEARQALQRLDQQLKSL   68 (171)
Q Consensus        47 ~eidpekAreaL~eLDqQLesL   68 (171)
                      .....++||++++++-+++++.
T Consensus        10 H~Lg~~eAr~~~e~~a~~l~~~   31 (91)
T TIGR02610        10 HSLGPAAARAKAEDLARKLTDR   31 (91)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHH
Confidence            4567899999999997776643


No 50 
>PF04834 Adeno_E3_14_5:  Early E3 14.5 kDa protein;  InterPro: IPR008131 The E3B 14.5 kDa was first identified in human adenovirus type 5. It is an integral membrane protein oriented with its C terminus in the cytoplasm. It functions to down-regulate the epidermal growth factor receptor and prevent tumour necrosis factor cytolysis. It achieves this through the interaction with E3 10.4 kDa protein [, ]. ; GO: 0009966 regulation of signal transduction, 0016021 integral to membrane
Probab=23.54  E-value=1.3e+02  Score=23.43  Aligned_cols=36  Identities=8%  Similarity=0.313  Sum_probs=27.0

Q ss_pred             CCccccchhHHHHHHHHHHHHHHHHHHHHHhhcccC
Q 030821           94 QETLEISGSFLTNTTVALLIFTILYNVLFYTVIKPS  129 (171)
Q Consensus        94 dE~pEiS~Sfla~sa~aLvifTIFyNVlF~tvIKPS  129 (171)
                      +++++||..+|-..+.++|++.-|.-++-|-.++=.
T Consensus        15 ~~~~d~~~~Wl~~i~~~~v~~~t~~~l~iYp~f~~g   50 (97)
T PF04834_consen   15 DKKSDMPNYWLYAIGIVLVFCSTFFSLAIYPCFDFG   50 (97)
T ss_pred             ccCCCCCHHHHHHHHHHHHHHHHHHHHhhhheeecc
Confidence            578999999998888888777666666666665543


No 51 
>PRK02251 putative septation inhibitor protein; Reviewed
Probab=23.27  E-value=1.1e+02  Score=23.27  Aligned_cols=28  Identities=21%  Similarity=0.458  Sum_probs=24.6

Q ss_pred             cccchhHHHHHHHHHHHHHHHHHHHHHh
Q 030821           97 LEISGSFLTNTTVALLIFTILYNVLFYT  124 (171)
Q Consensus        97 pEiS~Sfla~sa~aLvifTIFyNVlF~t  124 (171)
                      ..-|+.++.-..+||+++.+++=|+||+
T Consensus        27 ~~~sP~W~~~~m~~lm~~Gl~WlvvyYl   54 (87)
T PRK02251         27 TKSNPRWFVPLFVALMIIGLIWLVVYYL   54 (87)
T ss_pred             CCCCCchHHHHHHHHHHHHHHHHHHHhh
Confidence            3568889999999999999999999988


No 52 
>PF11239 DUF3040:  Protein of unknown function (DUF3040);  InterPro: IPR021401  Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed. 
Probab=23.23  E-value=2.7e+02  Score=19.52  Aligned_cols=16  Identities=25%  Similarity=0.625  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHhh
Q 030821           52 EEARQALQRLDQQLKS   67 (171)
Q Consensus        52 ekAreaL~eLDqQLes   67 (171)
                      |+=|++|+|+.+||..
T Consensus         5 e~E~r~L~eiEr~L~~   20 (82)
T PF11239_consen    5 EHEQRRLEEIERQLRA   20 (82)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            3447899999999853


No 53 
>PF08946 Osmo_CC:  Osmosensory transporter coiled coil;  InterPro: IPR015041 The osmosensory transporter coiled coil is a C-terminal domain found in various bacterial osmoprotective transporters, such as ProP, Proline/betaine transporter, Proline permease 2 and the citrate proton symporters. It adopts an antiparallel coiled-coil structure, and is essential for osmosensory and osmoprotectant transporter function []. ; PDB: 1R48_B.
Probab=22.99  E-value=32  Score=23.77  Aligned_cols=16  Identities=25%  Similarity=0.561  Sum_probs=10.4

Q ss_pred             HHHHHHHHHhhccccc
Q 030821           57 ALQRLDQQLKSLSNKQ   72 (171)
Q Consensus        57 aL~eLDqQLesLs~~q   72 (171)
                      ....+|+||..|-.++
T Consensus        20 kiedid~qIaeLe~KR   35 (46)
T PF08946_consen   20 KIEDIDEQIAELEAKR   35 (46)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHH
Confidence            3445788887776543


No 54 
>PF03579 SHP:  Small hydrophobic protein;  InterPro: IPR005327 The small hydrophobic integral membrane protein, SH (previously designated 1A) is found to have a variety of glycosylated forms [, ]. This protein is a component of the mature respiratory syncytial virion [] where it may form complexes and appears to play a structural role.; GO: 0016020 membrane, 0016021 integral to membrane, 0048222 glycoprotein network
Probab=22.87  E-value=71  Score=23.35  Aligned_cols=24  Identities=29%  Similarity=0.515  Sum_probs=20.4

Q ss_pred             CccccchhHHHHHHHHHHHHHHHH
Q 030821           95 ETLEISGSFLTNTTVALLIFTILY  118 (171)
Q Consensus        95 E~pEiS~Sfla~sa~aLvifTIFy  118 (171)
                      -..||++-|.+++++.-.++||-.
T Consensus         6 ~tIEFtskFW~YFtLi~M~lti~~   29 (64)
T PF03579_consen    6 TTIEFTSKFWTYFTLIFMMLTIGF   29 (64)
T ss_pred             EEeeeccccchHHHHHHHHHHHHH
Confidence            357999999999999988888753


No 55 
>PRK04989 psbM photosystem II reaction center protein M; Provisional
Probab=22.51  E-value=1.3e+02  Score=19.70  Aligned_cols=25  Identities=16%  Similarity=0.123  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhccc
Q 030821          103 FLTNTTVALLIFTILYNVLFYTVIKP  128 (171)
Q Consensus       103 fla~sa~aLvifTIFyNVlF~tvIKP  128 (171)
                      -++|.|.+||++ |=+-.|.++|||-
T Consensus         5 ~lgfiAt~Lfi~-iPt~FLlilYvqT   29 (35)
T PRK04989          5 DLGFVASLLFVL-VPTVFLIILYIQT   29 (35)
T ss_pred             HHHHHHHHHHHH-HHHHHHHHHheec
Confidence            467777777765 2333466777774


No 56 
>PF12129 Phtf-FEM1B_bdg:  Male germ-cell putative homeodomain transcription factor;  InterPro: IPR021980  This domain is found in bacteria and eukaryotes, and is typically between 101 and 140 amino acids in length. Phtf proteins do not display any sequence similarity to known or predicted proteins, but their conservation among species suggests an essential function. The 84 kDa Phtf1 protein is an integral membrane protein, anchored to a cell membrane by six to eight trans-membrane domains, that is associated with a domain of the endoplasmic reticulum (ER) juxtaposed to the Golgi apparatus. It is present during meiosis and spermiogenesis, and, by the end of spermiogenesis, is released from the mature spermatozoon within the residual bodies []. Phtf1 enhances the binding of FEM1B -feminisation homologue 1B - to cell membranes. Fem-1 was initially identified in the signaling pathway for sex determination, as well as being implicated in apoptosis, but its biochemical role is still unclear, and neither FEM1B nor PHTF1 is directly implicated in apoptosis in spermatogenesis. It is the ANK domain of FEM1B that is necessary for the interaction with the N-terminal region of Phtf1 []. 
Probab=21.93  E-value=2.8e+02  Score=23.23  Aligned_cols=51  Identities=27%  Similarity=0.327  Sum_probs=34.9

Q ss_pred             HHHhhcccccC--CCCCCccccccccCCCCCCCCCccccchhHHHHHHHHHHHH
Q 030821           63 QQLKSLSNKQI--SSPKIKAADVKITRGPGPAEQETLEISGSFLTNTTVALLIF  114 (171)
Q Consensus        63 qQLesLs~~q~--rpP~~~~sDv~~tr~~~~~~dE~pEiS~Sfla~sa~aLvif  114 (171)
                      .+|+||.++..  ..+|+--=||-+-||+.-. -.+||....-++--++.-++|
T Consensus        29 ~~l~gl~~~~kk~~~lk~dLIDvDLVRGStF~-KAKP~~~~~~l~~kgl~R~lf   81 (159)
T PF12129_consen   29 RELKGLTNKPKKTGHLKPDLIDVDLVRGSTFP-KAKPESPWTSLTRKGLVRVLF   81 (159)
T ss_pred             HHhcccccCCcccCCCChhheeeeeeeeeccc-ccCCcchhhHHHHHHHHHHHH
Confidence            45679987444  4455556889999999843 478888777777666655554


No 57 
>PRK14735 atpC F0F1 ATP synthase subunit epsilon; Provisional
Probab=21.63  E-value=1e+02  Score=23.91  Aligned_cols=20  Identities=35%  Similarity=0.410  Sum_probs=18.4

Q ss_pred             cCCHHHHHHHHHHHHHHHhh
Q 030821           48 EIDPEEARQALQRLDQQLKS   67 (171)
Q Consensus        48 eidpekAreaL~eLDqQLes   67 (171)
                      +||.++|++++++..++|+.
T Consensus        86 dID~~~a~~a~e~Ae~~l~~  105 (139)
T PRK14735         86 EIDEARAEQARAEAEQRRRE  105 (139)
T ss_pred             cCCHHHHHHHHHHHHHHHHh
Confidence            79999999999999998865


No 58 
>COG2012 RPB5 DNA-directed RNA polymerase, subunit H, RpoH/RPB5 [Transcription]
Probab=21.49  E-value=65  Score=24.40  Aligned_cols=45  Identities=33%  Similarity=0.443  Sum_probs=30.3

Q ss_pred             cCCHHHHHHHHHHHHHHHhhcccccCCCCC-----Ccccc-ccccCCCCCC
Q 030821           48 EIDPEEARQALQRLDQQLKSLSNKQISSPK-----IKAAD-VKITRGPGPA   92 (171)
Q Consensus        48 eidpekAreaL~eLDqQLesLs~~q~rpP~-----~~~sD-v~~tr~~~~~   92 (171)
                      -++.||+.+-|++|+-.-+.|-.=+..-|-     .+.-| ++|.|.++..
T Consensus        20 vls~eE~~~vLk~l~i~~~qLPkI~~~DPva~~lgak~GdvVkIvRkS~Ta   70 (80)
T COG2012          20 VLSEEEAKEVLKELGIEPEQLPKIKASDPVAKALGAKPGDVVKIVRKSPTA   70 (80)
T ss_pred             EcCHHHHHHHHHHhCCCHHHCCcccccChhHHHccCCCCcEEEEEecCCCC
Confidence            578899999999998766666443333332     12345 6788888754


No 59 
>PRK10409 hydrogenase assembly chaperone; Provisional
Probab=21.29  E-value=1.1e+02  Score=23.11  Aligned_cols=19  Identities=32%  Similarity=0.482  Sum_probs=17.1

Q ss_pred             cCCHHHHHHHHHHHHHHHh
Q 030821           48 EIDPEEARQALQRLDQQLK   66 (171)
Q Consensus        48 eidpekAreaL~eLDqQLe   66 (171)
                      .||.++|++.|+-|++-++
T Consensus        58 ~ideeeA~etl~~l~ei~~   76 (90)
T PRK10409         58 VINEAEARDTLDALQNMFD   76 (90)
T ss_pred             hCCHHHHHHHHHHHHHHHh
Confidence            7899999999999988886


No 60 
>PF01484 Col_cuticle_N:  Nematode cuticle collagen N-terminal domain;  InterPro: IPR002486 The function of this domain is unknown. It is found in the N-terminal region of nematode cuticle collagens (see IPR008160 from INTERPRO). Cuticle is a tough elastic structure secreted by hypodermal cells and is primarily composed of collagen proteins [, ].; GO: 0042302 structural constituent of cuticle
Probab=20.84  E-value=1.3e+02  Score=18.75  Aligned_cols=17  Identities=12%  Similarity=0.190  Sum_probs=7.0

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 030821          104 LTNTTVALLIFTILYNV  120 (171)
Q Consensus       104 la~sa~aLvifTIFyNV  120 (171)
                      +++.+.++-+++++..+
T Consensus         2 va~~a~~~s~~ai~~~l   18 (53)
T PF01484_consen    2 VAYGAIVVSTVAILSCL   18 (53)
T ss_pred             hhhHHHHHHHHHHHHHH
Confidence            34444444444444333


No 61 
>CHL00019 atpF ATP synthase CF0 B subunit
Probab=20.83  E-value=1e+02  Score=24.40  Aligned_cols=23  Identities=17%  Similarity=0.205  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHHHHHHHHhhccc
Q 030821          106 NTTVALLIFTILYNVLFYTVIKP  128 (171)
Q Consensus       106 ~sa~aLvifTIFyNVlF~tvIKP  128 (171)
                      ++..-++-|.|+..+|++..-||
T Consensus        26 ~~~~~~Inflill~lL~~fl~kP   48 (184)
T CHL00019         26 ILETNLINLSVVLGVLIYFGKGV   48 (184)
T ss_pred             HHHHHHHHHHHHHHHHHHHhHhH
Confidence            33445888999999999988888


No 62 
>PRK10204 hypothetical protein; Provisional
Probab=20.71  E-value=97  Score=22.12  Aligned_cols=23  Identities=22%  Similarity=0.284  Sum_probs=18.3

Q ss_pred             CCcccCCHHHHHHHHHHHHHHHh
Q 030821           44 NSKFEIDPEEARQALQRLDQQLK   66 (171)
Q Consensus        44 ~~q~eidpekAreaL~eLDqQLe   66 (171)
                      ...-.+..|+|..+|.+|.-|-+
T Consensus        32 ~p~vtlt~eeA~aRl~~LRr~Ye   54 (55)
T PRK10204         32 MPLVTLTAEEALARLEELRRHYE   54 (55)
T ss_pred             cccccccHHHHHHHHHHHHHHhc
Confidence            34557889999999999987653


No 63 
>PF09650 PHA_gran_rgn:  Putative polyhydroxyalkanoic acid system protein (PHA_gran_rgn);  InterPro: IPR013433  Proteins in this entry are encoded by genes involved in either polyhydroxyalkanoic acid (PHA) biosynthesis or utilisation, including proteins at found at the surface of PHA granules. These proteins have so far been predominantly found in the Pseudomonadales, Xanthomonadales, and Vibrionales, all of which belong to the Gammaproteobacteria.
Probab=20.65  E-value=1.3e+02  Score=21.80  Aligned_cols=22  Identities=27%  Similarity=0.397  Sum_probs=17.9

Q ss_pred             ccCCHHHHHHHHHHHHHHHhhc
Q 030821           47 FEIDPEEARQALQRLDQQLKSL   68 (171)
Q Consensus        47 ~eidpekAreaL~eLDqQLesL   68 (171)
                      .....|+||++++++=.++++-
T Consensus         7 H~Lg~~eAr~~~~~~~~~l~~~   28 (87)
T PF09650_consen    7 HSLGREEARRRAEELAEKLAEE   28 (87)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHH
Confidence            3567899999999998888753


No 64 
>PRK00159 putative septation inhibitor protein; Reviewed
Probab=20.64  E-value=1.2e+02  Score=22.96  Aligned_cols=28  Identities=14%  Similarity=0.235  Sum_probs=24.4

Q ss_pred             cccchhHHHHHHHHHHHHHHHHHHHHHh
Q 030821           97 LEISGSFLTNTTVALLIFTILYNVLFYT  124 (171)
Q Consensus        97 pEiS~Sfla~sa~aLvifTIFyNVlF~t  124 (171)
                      ..-|+..++-..+||+++.+++=|+||+
T Consensus        26 ~~~sp~W~~~~m~glm~~GllWlvvyYl   53 (87)
T PRK00159         26 AGPSSVWYVVLMLGLMLIGLAWLVVNYL   53 (87)
T ss_pred             CCCCCccHHHHHHHHHHHHHHHHHHHhh
Confidence            4457889999999999999999999987


Done!